SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000037160 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000037160
Domain Number 1 Region: 438-495
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.3e-26
Family Classic zinc finger, C2H2 0.0027
Further Details:      
 
Domain Number 2 Region: 186-243
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.19e-26
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 3 Region: 382-439
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.17e-24
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 4 Region: 242-299
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.08e-24
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 5 Region: 299-355
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.66e-23
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 6 Region: 148-200
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.03e-21
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 7 Region: 480-532
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.75e-18
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 8 Region: 712-789
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000457
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 9 Region: 345-377
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000179
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 10 Region: 659-693
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000368
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number 11 Region: 565-598
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000404
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 12 Region: 835-865
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000398
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000037160   Gene: ENSBTAG00000026307   Transcript: ENSBTAT00000037326
Sequence length 868
Comment pep:known chromosome:UMD3.1:25:27159691:27181614:-1 gene:ENSBTAG00000026307 transcript:ENSBTAT00000037326 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPETALWGPDLQDPGQSPDDGHPGAESGNEEESTQHESSGEEVILGDPDQSPEFKDPSE
MPLETPSQDASGPQDAPAPLGHANPSDHQTPLDTPSPEVVPTPSDWTKACEASWQWGTLT
TWNSPPVVPANEPSLRELVQGRPAGAEKPYICNECGKSFSQWSKLLRHQRIHTGERPNTC
SECGKSFTQSSHLVQHQRTHTGEKPYKCPDCGKCFSWSSNLVQHQRTHTGEKPYKCTECE
KAFTQSTNLIKHQRSHTGEKPYKCGECRRAFYRSSDLIQHQATHTGEKPYKCPECGKRFG
QNHNLLKHQKIHAGEKPYRCTECGKSFIQSSELTQHQRTHTGEKPYECLECGKSFGHSST
LIKHQRTHLREDPFKCPVCGKTFTLSATLLRHQRTHTGERPYKCPECGKSFSVSSNLINH
QRIHRGERPYICADCGKSFIMSSTLIRHQRIHTGEKPYKCSDCGKSFIRSSHLIQHRRTH
TGEKPYKCPECGKSFSQSSNLITHVRTHMDENLFVCSDCGKAFLEAHELEQHRVIHERGK
TPARRAQGDGLLGLGDPALLTPPPGAKPHKCLVCGKGFNDEGIFMQHQRIHIGENPYKNS
DGLPAHPAPKPPQFRSPRLPFGGNSFPGAAEGRADPPGQPFKMPDGQESFSHRLGLPSSK
SYICSHCGESFLDRSVLLQHQVTHGNEKPYLFPDYRIGLGEGAGPSPFLSGKPFKCPECK
KSFALSSELLLHQKVHAGGKAQKSPELGKSSSVLLEHLRSPLGARPYSCSDCGASFLDRL
ALIRHQETHTQEKSPIPEDPLPEPATLSTSQEGEGEAPAPTESSSHEEGGSPKTSLEEKP
YLCPECGDGFTEVSALLLHRSCHPGVTL
Download sequence
Identical sequences F1MTC4
NP_001193135.1.59421 NP_001193135.1.76553 XP_005225018.1.76553 XP_005225019.1.76553 ENSBTAP00000037160 ENSBTAP00000037160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]