SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000037163 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000037163
Domain Number 1 Region: 105-160
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.2e-21
Family Classic zinc finger, C2H2 0.00038
Further Details:      
 
Domain Number 2 Region: 69-103
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.86e-16
Family Classic zinc finger, C2H2 0.0018
Further Details:      
 
Domain Number 3 Region: 630-698
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000556
Family Homeodomain 0.0026
Further Details:      
 
Domain Number 4 Region: 444-500
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000423
Family Homeodomain 0.0026
Further Details:      
 
Domain Number 5 Region: 530-582
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000321
Family Homeodomain 0.0008
Further Details:      
 
Domain Number 6 Region: 275-326
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000599
Family Homeodomain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000037163   Gene: ENSBTAG00000026309   Transcript: ENSBTAT00000037329
Sequence length 838
Comment pep:known chromosome:UMD3.1:14:18386657:18389173:-1 gene:ENSBTAG00000026309 transcript:ENSBTAT00000037329 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASKRKSTTPCMVRTSQVVEQDVPEEADRAKEKGIGVPQPETAKDTWAAEPENSSKENEV
IEVKSTGENQSKKLQGGYECKYCPYSTQNLNEFTEHVDMQHPNVILNPLYVCAECNFTTK
KYDSLSDHNSKFHPGETNFKLKLIKRNNQTVLEQSIDATNHIVSITTSGPGSGDGDAGIS
VSKTPIMKPGKPKADAKKVPKKPEEATPENHVEGTARLVTDAAEILSRLGGVELLQDSLG
HVMPSVQLPPNINLVPKVPVPLNTTKYNSALDTNATMINSFNKFPYPTQAELSWLTAASK
HPEEHIRIWFATQRLKHGISWSPEEVEEARKKMFNGTIQSVPPTITVLPAQLAPTKMSQP
ILQTALPCQILGQTSLVLTQVTSGPATVSCSPITLAVAGVTNHGQKRPLVTPQAAPEPKR
PHVAQVPEPPPKVANPSLTPASDRKKTKEQIAHLKASFLQSQFPDDAEVYRLIEVTGLAR
SEIKKWFSDHRYRCQRGIVHITSESLAKDQLALAASRHGRTYHAYPDFAPQKFKEKTQGQ
VKILEDSFLKSSFPTQAELDRLRVETKLSRREIDSWFSERRKLRDSMEQAVLDSMGSGKK
GPDAAAPNGALSRLDQLSSAQLASSLPSPSPAITKSQEQVHLLRSTFARTQWPTPQEYDQ
LAAKTGLVRTEIVRWFKENRCLLKTGTLKWLEQYQPQHVVDDHGYDTPSRKVVKTVITEN
PKNGSEGGHQYYKDPKKLCDEDLEKPGPRGKAGGEQVKDNLPAKPSEATSDRSEGNSRDG
QASDENEESGVVDWVEVTVGEEDAASDRSDSWSQTAAEGAGELADSDSDSGPAEASQA
Download sequence
Identical sequences F1MTC3
ENSBTAP00000037163 NP_001193335.1.59421 NP_001193335.1.76553 XP_005215419.1.76553 XP_010810254.1.76553 XP_010810255.1.76553 XP_010810256.1.76553 XP_010810257.1.76553 ENSBTAP00000037163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]