SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000037199 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000037199
Domain Number 1 Region: 521-578
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.46e-25
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 2 Region: 465-522
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.57e-25
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 3 Region: 302-359
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.92e-25
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 
Domain Number 4 Region: 344-396
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.63e-21
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 5 Region: 28-89
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.48e-20
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 6 Region: 264-316
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.14e-19
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 7 Region: 648-700
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.48e-19
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 8 Region: 567-619
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.62e-19
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 9 Region: 427-479
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.61e-19
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 10 Region: 212-249
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000065
Family Classic zinc finger, C2H2 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000037199   Gene: ENSBTAG00000018456   Transcript: ENSBTAT00000037366
Sequence length 702
Comment pep:known chromosome:UMD3.1:14:1517535:1523303:1 gene:ENSBTAG00000018456 transcript:ENSBTAT00000037366 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLDLDPRPLADPLPVSGVSKPGDWCVSFQEAVTFGDVAVHFSREEWQCLDPGQRALYKE
VMLENHSSVAGLAGFLVFKPELISRLEQGQDPWVLDLQGAEGREEARTTRTDSTVGTDGE
QDMDSFKSESGGVMVKTLPQNFPQSPGFGNTSDPEVCSQRQPTSLFHKNFLNMGTMGPRK
AFTEDEFQGHGEWGSSGRLGCQPDQSQWSFGRCDVCGRSLRSPSDAALHQEVNTQQKPNR
CQECQKQLSDCFQGRPLSTFPGEKPYECRECGKVFRLCSQLTQHQRIHTGEKPFKCTDCG
KAFRLSSKLIQHQRIHTGEKPYRCEECGKAFGQSSSLIHHQRVHTGERPYGCRECGKAFS
QQSQLARHQRTHTGERPYPCRECGKAFSQSSTLAQHQRMHAAEKLELPRTPESPSLGARQ
RMHVPEKPFKCDECGKAFRWVSRLSQHQLTHTGEKPYKCNKCSKAFGCSSRLIRHQRTHT
GEKPFKCDECGKGFVQGSHLIQHQRIHTGEKPYECSDCGKAFSQSSSLIYHQRIHKGEKP
YECLECGKAFSMSTQLTIHQRVHTGERPYKCSECGKAFSQNSTLFQHQIIHAGVKPYGCS
ECGKAFSRSSYLIEHQRIHTRAQWYREYGSTLEASTHTSRRRVNTVKKLHKCNECEKIFR
WRSHLIIHQRIHTGEKPYKCNECDKAFNRSSRLTQHQKIHMG
Download sequence
Identical sequences E1BFY1
ENSBTAP00000037199 ENSBTAP00000037199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]