SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000037355 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000037355
Domain Number 1 Region: 39-128
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 4.58e-37
Family SCAN domain 0.0000565
Further Details:      
 
Domain Number 2 Region: 359-416
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.96e-23
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 3 Region: 321-373
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.11e-19
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 4 Region: 401-453
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.79e-19
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 5 Region: 204-246
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000000101
Family KRAB domain (Kruppel-associated box) 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000037355   Gene: ENSBTAG00000026408   Transcript: ENSBTAT00000037526
Sequence length 465
Comment pep:known chromosome:UMD3.1:25:2573737:2576729:1 gene:ENSBTAG00000026408 transcript:ENSBTAT00000037526 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPPEPQDQAPEEGEGLLIVKIEDSSWEQDSAQPEDHGDPEVCRQRFRQFCYGDAGGPH
EAFSQLWELCCRWLRPELRTKEQILELLVLEQFLSVLPLGVQDWVCQRCPGSGEEAVALV
EDLQKQPVKAWSQDVPSERAEPEAAVQGSQAQGPPWRAGTRSRPPVPWEPHSRGAQLPAL
KQGSTRETTDTCFASGVSYPSLCPLGPVTFGDIPFYFSREEWGSLDPAQRDLFWDIKREN
SRNVALGLGHRSHSEKSRLEEVVTALPDQAAGNETASWRPEEAEAWEGGARPGAPRGRVV
GARRGRPPTHRRQLRDLAAEKPHSCGQCGKRFRWGSDLARHQRTHTGEKPHKCQECDKSF
RSSSDLVRHQGVHTGQKPFSCTQCGKSFSRSAYLADHQRIHTGEKPFGCSDCGKSFSLRS
YLLDHRRVHTGERPFGCGECDKSFKQRAHLIAHQSLHAKMAQPVG
Download sequence
Identical sequences E1BA48
ENSBTAP00000037355 ENSBTAP00000037355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]