SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000037357 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000037357
Domain Number 1 Region: 2-73
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.66e-22
Family SCAN domain 0.00019
Further Details:      
 
Domain Number 2 Region: 560-617
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.94e-21
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 3 Region: 504-561
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.56e-20
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 4 Region: 617-683
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.02e-18
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 5 Region: 466-518
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.94e-18
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 6 Region: 673-724
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.43e-17
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 7 Region: 328-385
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.78e-17
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Domain Number 8 Region: 291-342
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000251
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number 9 Region: 423-457
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000107
Family Classic zinc finger, C2H2 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000037357   Gene: ENSBTAG00000034238   Transcript: ENSBTAT00000037528
Sequence length 730
Comment pep:known chromosome:UMD3.1:25:2536214:2540270:-1 gene:ENSBTAG00000034238 transcript:ENSBTAT00000037528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPRASLSRLRELCNHWLRPALHTKKQILELLVLEQFLSVLPPHLLARLQGQQLRDGEEV
VLLLEGVQRESSNVGPLDFSFNAGKNCPRADVTLEEQGGSFQVSSHSPKKEAASEGPPAL
EPSQALPPSQSGPSKPAEMGDWRRPLSSRQPLSPGPKRTLQAPQESALQGPELWPEESSG
DQELAAVLESLTFEDVPAKKAWPVHPLGTGGRTLEEAFKAEEPKGVSWPSAASANSQAES
PRVAEEPHAQSLGSGPETSSPGGEMSPPGRSDVLKVKAAEDAPKSDPEFKFICTDCGISF
PQLARLEAHQLRSHPGARSFLCLCCGKAFGRSSILKLHMRTHTDERPHTCHLCGHRFRQS
SHLNKHLQTHSSEPAFLCAECGQGFQRRARLTQHLLAHAQDQKPPGGTPETKPPAPPELT
VVLCSHCGQTFQRRSSLKRHLRIHAKDKGHQCSECSGSLRPGPERRPYVCGECGKAFRRS
EHLGAHWRVHTGERPFSCQVCGRSFSQSSQLVCHQRVHTGEKPYGCPHCGKRFMRRAGLA
RHLLTHGGPRPHHCTQCGKSFSQTQDLARHRRSHTGEKPCRCSECGEGFSQSAHLARHQR
IHTGEKPHVCDTCGHRFRNSSNLARHRRSHTGERPYSCEQCGRSFRRNAHLQRHLATHAG
AGDEAASGPAEPPQECPECGKVFSRSCNLLRHMLVHTGARPYSCTQCGRSFSRNSHLLRH
LRTHARETLY
Download sequence
Identical sequences E1BA35
ENSBTAP00000037357 NP_001179042.1.59421 NP_001179042.1.76553 ENSBTAP00000037357

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]