SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000037548 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000037548
Domain Number 1 Region: 99-150
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000015
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 2 Region: 1-48
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000685
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000037548   Gene: ENSBTAG00000026523   Transcript: ENSBTAT00000037724
Sequence length 407
Comment pep:known chromosome:UMD3.1:9:82419235:82420458:-1 gene:ENSBTAG00000026523 transcript:ENSBTAT00000037724 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATHSPQKSHRCAYCEKTFNRKDHLKNHLQTHDPNKMAFGCEECGKKYHTMLGYKRHLAL
HAASSGDLTCGVCALELGSTEVLLDHLKAHAEEKPSTGTKEKKHQCDHCDRCFYTRKDVR
RHLVVHTGCKDFLCQFCAQRFGRKDHLTRHTKKTHPQELMKESLQAGDLLNTLHALSPQF
QLKAAPLSPFPIGAPTQNGLAGSLPAEVHTLNALEQAPQPISVLSELLAPLHPMATPSSP
PAPLQNHKYSAGSTSYAPLAGLPLKTDTKGFCSANLLEDLPLQEPQSPHKLNAGFDLAKG
GAGKVNLPKELAADAVNILPASLDLSPLLGFWQLPPATQNAFGSSGLALGAGESLPHRLG
CLGQQPQDPSLAMSTMSLGQLPLPPIPHVFPAGTGSAILPHFHHAFR
Download sequence
Identical sequences F6R951
ENSBTAP00000037548 XP_005211066.1.76553 XP_005211069.1.76553 XP_005889146.1.15283 XP_010849781.1.44457 XP_010849782.1.44457 XP_010849783.1.44457 XP_015328379.1.76553 XP_015328380.1.76553 XP_019823101.1.53367 XP_019823102.1.53367 XP_019823103.1.53367 XP_019823104.1.53367 XP_019823105.1.53367 ENSBTAP00000037548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]