SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000037965 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000037965
Domain Number 1 Region: 167-218
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000266
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 2 Region: 233-282
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000502
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number 3 Region: 119-181
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000332
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000037965   Gene: ENSBTAG00000015504   Transcript: ENSBTAT00000038149
Sequence length 467
Comment pep:known chromosome:UMD3.1:20:31571710:31578258:1 gene:ENSBTAG00000015504 transcript:ENSBTAT00000038149 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RNKENSAPLEENTTGKSEAKKRKIAETSNVITESLPSAESEPVEIEVEIAEGTIEVEDEG
IETLEEVASAKQSIKYIQSTGSSDDSALALLADITSKYRQGDRKGQIKDEDGCASDPTSK
QEHMKSHSTESFKCEICNKRYLRESAWKQHLSCYHLEEGGVSKKQRTGKKIHICQYCEKQ
FDHFGHFKEHLRKHTGEKPFECPNCHERFARNSTLKCHLTACQTGVGAKKGRKKLYECQV
CNSVFNSWDQFKDHLVIHTGDKPNHCTLCDLWFMQGNELRRHLSDTHNISERLVTEEVLS
VETRVQTEPVTSMTIIEQVGKVHVLPLLQVQVDSAQVTVEQVHPDLLQDSQVHESHVSEL
PEQVQVSYLEVGRIQTEEGTEVHVEELHVERVNQMPVEVQTELLEADLEQVTPEIMNQEE
REPTQADAAEAAIEEHEDAEDLETKSTVDSQAEKAGNENRTPMPVLE
Download sequence
Identical sequences F6S103
ENSBTAP00000037965 ENSBTAP00000037965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]