SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000037989 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000037989
Domain Number 1 Region: 490-589
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000622
Family Ankyrin repeat 0.0044
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000037989
Domain Number - Region: 69-103
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0143
Family Classic zinc finger, C2H2 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000037989   Gene: ENSBTAG00000020610   Transcript: ENSBTAT00000038173
Sequence length 728
Comment pep:known chromosome:UMD3.1:2:107902020:107908498:1 gene:ENSBTAG00000020610 transcript:ENSBTAT00000038173 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPAPAATQAPVSVSLFDLSTDAPVLQGLRLVSHFPEEALAQSLQTSCPGSEEQISPERR
PFQGALDISEKLFCSTCDQVFQNHQEQREHYKLDWHRFNLKQRLKDKPLLSALDFEKQSS
TGDLSSISGSEDSDSDSEEDLQILDEERADLEKPTRPQGFHPHRVLFQNAQGQFLYAYRC
VLGPRHASASTYCVVPLEESELLLQNLQTGGPRDCVVLMAAAGHFAGAIFQGREVLTHKT
FHRYTVRAKRGTAQGLRDARGAAAHSAGASLRRYNEAALYKEVRDLLAGPAWAKALEEAG
TILLRAPRSGRSLFFGGREAPLRRGDPRLWDIPLATRRPTFQELQRVVHKLTTLHIHGED
PRETSRLDLPQTHRKRVRERKVIEEESKVPSDENEALGQNKEAPTQGSESEGGDGSQVEL
ELVEVTLGTLDLREFDVFPKQRRRKRNKRERKQDLESGAQMTLSQQPKEDEALSGSAPLR
PPLDEATSPCQSELWDVLLAACRAGDVGMLKDRLTASPLHPGVLPLLSAPLGSGGFTLLH
AAAAAGRGSVVRLLLEAGADPTVQDSRARPPYTVAADRSTRNEFRRFMEKNPDAYDYSKA
QVPGPLTAEMEARQATRRREQKAARRHREEQQRKQQEQEKQEQEEQQRFAALSDREKRAL
AAERRLAAQLGALNPQTPDPAITVSNIPRCWSCGMSLQGLVPFHYLDFSFCSTRCLRDHR
CQAGKPSS
Download sequence
Identical sequences Q58CQ5
9913.ENSBTAP00000037989 ENSBTAP00000037989 NP_001019668.2.59421 NP_001019668.2.76553 XP_005202877.1.76553 ENSBTAP00000037989

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]