SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000038002 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000038002
Domain Number 1 Region: 373-613,646-722
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 3.49e-53
Family Diacylglycerol kinase-like 0.015
Further Details:      
 
Domain Number 2 Region: 1-117
Classification Level Classification E-value
Superfamily EF-hand 9.26e-45
Family EF-hand modules in multidomain proteins 0.00000728
Further Details:      
 
Domain Number 3 Region: 185-251
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000000389
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.014
Further Details:      
 
Domain Number 4 Region: 99-182
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000025
Family Calmodulin-like 0.031
Further Details:      
 
Domain Number 5 Region: 255-323
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000224
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000038002   Gene: ENSBTAG00000004018   Transcript: ENSBTAT00000038186
Sequence length 734
Comment pep:known chromosome:UMD3.1:5:57678063:57699615:-1 gene:ENSBTAG00000004018 transcript:ENSBTAT00000038186 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKERGLISPSDFAQLQKYMEYSTKKVSDVLKLFEDGEMAEYLQGDAIGYEGFQQFLKIY
LEVDNVPDHLSQALFQSFQTGYYIEDTVREDVVCLSDVSCYFSLLEGGRPEDKLEFTFKL
YDTDRNGILDSSEVDRIIIQMMRMAEYLDWDVSELRPILQEMMKEIDYDGSGSVSLAEWL
RAGATTVPLLVLLGLEMTLKDNGQHMWRPKRFPRPVYCNLCESSIGLGKQGLSCNLCKYI
VHDQCAMKALPCEVSTYAKSRKDIGVQSHVWVRGGCESGRCDRCQKKIRIYHSLVGLHCV
WCHLEIHDDCLPAMGHECDCGLLRDHILPPSSIYPSVLASGQERKTSKISQKTMDDLSLS
TSEALRIDPVSNTHPLLVFVNPKSGGKQGERVLWKFQYLLNPRQVFNLLKDGPEPGLRFF
RDVPDYRILVCGGDGTVGWILESIDKANLPFVPPVAVLPLGTGNDLARCLRWGGGYEGQN
LGKILKDLETSKVVHMDRWSVEVIPQQTEEKSDPVPFQIINNYFSIGVDASIAHRFHIMR
EKYPEKFNSRMKNKLWYFEFATSESIFSTCKKLEESLTVEICGKPLDLSNLSLEGIAVLN
IPSTHGGSNLWGDTKRPHGDIHGINQALGATAKVITDPDILKTCVPDLSDKRLEVVGLEG
AIEIGQIYTKLKNAGHRLAKCSEITFHTTKTLPMQIDGEPWMQTPCTIKITHRNQMPMLV
GPPPRSSNFFGFLC
Download sequence
Identical sequences A0JN54
ENSBTAP00000038002 9913.ENSBTAP00000038002 ENSBTAP00000038002 NP_001071328.1.59421 NP_001071328.1.76553 XP_005206587.2.76553 XP_010837500.1.44457 XP_010837501.1.44457 XP_019816634.1.53367 XP_019816635.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]