SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000038047 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000038047
Domain Number 1 Region: 900-951
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000209
Family Erythroid transcription factor GATA-1 0.0024
Further Details:      
 
Domain Number 2 Region: 1228-1275
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000402
Family Classic zinc finger, C2H2 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000038047   Gene: ENSBTAG00000017694   Transcript: ENSBTAT00000038232
Sequence length 1293
Comment pep:known chromosome:UMD3.1:14:50844179:51066191:1 gene:ENSBTAG00000017694 transcript:ENSBTAT00000038232 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPYEVNAGYDFTNMVRKKNPPLRNIASEGEGQTLEPVGTESKGPGKNKEFSADQMSENTD
QSDATELNNKEEHSLHVQDPSSSSKKDLKSSVLSEKAGFNYENSSKGGNLPSYSHDEVTE
RNMLAFSSPAAGGVCEPLKSPQRAEADDPQDMACTPSGDSLEMKEDQKMSPKATEETGQV
QSGQANCQGSSPVSVASKNPQVPSDGGVRLNKSKTDVLVNDNPDPAPLSPELQDFKCNIC
GYGYYGNDPTDLIKHFRKYHLGLHNRTRQDAELDSKILALHNMVQFSHSKDFQKVNRSVL
SGVLQDISSSRPVLLNGTYDVQVTSGGTFIGIGRKTPDCQGNTKYFRCKFCNFTYMGNSS
TELEQHFLQTHPNKIKASLPSSEGAKPSEKNSNKSIPAVRSGDAGDLGKWQDKITVKAGD
DSPVGYSVPIKPLDSRQNGTEATSYYWCKFCSFSCESSSSLKLLEHYGKQHGGVQSGGLN
PELNDKLSRGSVINQNDLAKSAEGEPMTKADKGSSGVKKKDFSSKGAEDNMVTSYNCQFC
DFRYSKSHGPDVIVVGPLLRHYQQLHNIHKCTIKHCPFCPRGLCSPEKHLGEITYPFACR
KSNCSHCALLLLHLSPGAAGSSRVKHQCHQCSFSTPDVDVLLFHYESAHESQASDVKQEG
SHLQGPDGQPAVKESKEHSCTKCDFITQVEEEISRHYRRAHSCYKCRQCSFTAAETQSLL
EHFNTVHCQEQDSTTANGEEDGHAVSTIKEEPKIDLKVYSLLNPDSKMGEPVAESVVKRE
KLEDKDGLKEKAWAESSSDDLRSVTWRGADILRGSPSYTQASLGLLTPVSGPQEQTKTLR
DSPNVEAAHLARPIYGLAVDTKGFLQGAPAGGEKAGALPQQYPASGESKSKDESQSLLRR
RRGSGVFCANCLTTKTSLWRKNANGGYVCNACGLYQKLHSTPRPLNIIKQNNGEQIIRRR
TRKRLNPEALQAEQLNKQQRAGSEEQVNGSPLERRSEDHLTEGHQREIPLPSLSKYEAQG
SLTKSHSAQQPVLVSQTLDIHKRMQPLHIQIKSPQESTGDPGNSSSVSEGKGSSERGSPI
EKYMRPAKHPNYSPPGSPIEKYQYPLFGLPFVHNDFQSEADWLRFWSKYKLSVPGNPHYL
SHVPGLPNPCQNYVPYPTFNLPPHFSAVGSDNDIPLDLAIKHSRPGPTANGASKEKTKAP
SNVKNEGPLNVVKTEKVDRSTQDELSTKCVHCGIVFLDEVMYALHMSCHGDSGPFQCSIC
QHLCTDKYDFTTHIQRGLHRNNAQVEKNGKPKE
Download sequence
Identical sequences E1BBB8
NP_001179842.1.59421 NP_001179842.1.76553 XP_010810445.1.76553 ENSBTAP00000038047 ENSBTAP00000038047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]