SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000038286 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000038286
Domain Number 1 Region: 10-124
Classification Level Classification E-value
Superfamily POZ domain 8.11e-31
Family BTB/POZ domain 0.00094
Further Details:      
 
Domain Number 2 Region: 397-449
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000021
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 3 Region: 376-405
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000018
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000038286   Gene: ENSBTAG00000004361   Transcript: ENSBTAT00000038473
Sequence length 505
Comment pep:known chromosome:UMD3.1:16:56696960:56706787:1 gene:ENSBTAG00000004361 transcript:ENSBTAT00000038473 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TTMEKSGNIQLEIPDFSNSVLSHLNQLRMQGRLCDIVVNVQGQAFRAHKVVLAASSPYFR
DHMSLNEMSTVSISVIKNPTVFEQLLSFCYTGRICLQLADIISYLTAASFLQMQHIIDKC
TQILEGIHFKINVAEVEAELSQTRTKHAEGPPESHRVTPNLNRSLSPRHNTLKGNRRGQV
SAVLDIRELSPPEESTSPQIIEQSSDVESREPILRINRAGQWYVETGVADRGARSDDEVR
VLGAVHIKTENLEEWLGPENQPSGEDGSSAEEVTAMVIDTTGHGSVGQENYALGSSGAKV
ARPTSSEIDRFSPSGSVVPLTERHRARSESPGRMDEPKQPTSQVEESAMMGVSGYVEYLR
EQEVSERWFRYNPRLTCIYCAKSFNQKGSLDRHMRLHMGITPFVCRMCGKKYTRKDQLEY
HIRKHTGNKPFHCHVCGKSFPFQAILNQHFRKNHPGCIPLEGPHSISPETTVTSRGQAEE
ESPSQEETVASGETAQGSVSTTGPD
Download sequence
Identical sequences F1N518
9913.ENSBTAP00000038286 ENSBTAP00000038286 ENSBTAP00000038286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]