SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000038377 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000038377
Domain Number 1 Region: 59-137
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000631
Family HkH motif-containing C2H2 finger 0.039
Further Details:      
 
Domain Number 2 Region: 265-320
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000834
Family Classic zinc finger, C2H2 0.079
Further Details:      
 
Domain Number 3 Region: 210-259
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000774
Family C2HC finger 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000038377   Gene: ENSBTAG00000015604   Transcript: ENSBTAT00000038564
Sequence length 414
Comment pep:known chromosome:UMD3.1:5:25807926:25823618:1 gene:ENSBTAG00000015604 transcript:ENSBTAT00000038564 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AEPREGDAVRPRPLGGQGQATAWGQRAPDTEGSLSRAGPLPLLRQPPIMQPPLDLKQILP
FPLEPAPTLGLFSNYSAMDPVQKAVLSHTFGGPLLKTKRPIISCNVCQIRFNSQSQAEAH
YKGNRHARRVKGIEAAKTRGREPSVREPGDPAPPGSTPPNGDGVAPRPVSMENGVGPAPG
SPKKQPGSPSPPSVPETGQGATKGEGGTPAPASLPGGSKEEEEKAKRLLYCALCKVAVNS
LSQLEAHNKGTKHKTILEARSGLGPIKAYPRLGPPTPGEPEAPAQDRTFHCEICNVKVNS
EVQLKQHISSRRHRDGVAGKPNPLLSRHKKPRGAGELAGTLTFSKELPKSLAGGLLPSPL
AVAAVMAAAAGSPLSLRPAPAAPLLQGPPITHPLLHPAPGPIRTAHGPILFSPY
Download sequence
Identical sequences Q08DL3
9913.ENSBTAP00000038377 ENSBTAP00000038377 ENSBTAP00000038377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]