SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000038429 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000038429
Domain Number 1 Region: 179-319
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000196
Family Spectrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000038429   Gene: ENSBTAG00000001861   Transcript: ENSBTAT00000038616
Sequence length 413
Comment pep:known chromosome:UMD3.1:2:17708890:17730680:1 gene:ENSBTAG00000001861 transcript:ENSBTAT00000038616 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVNWLEGPGSEQLRAQWGIGDSIRASQALQQKHEEIESQHSEWFAVYVELNQQIAALLNA
GDEEDLVELKSLQQQLSDVCYRQASQLEFRQNLLQAALEFHGVAQDLSQQLDGLLGMLCV
DVAPADGASIQQTLKLLEEKLKSVDVGLQGLREKGQGLLDQISNQASWAYGKDVTIENKE
NVDHIQGVMEDMQLRKQRCEDMVDVRRLKMLQMVQLFKCEEDAAQAVEWLSELLDALLKT
HTRLGDDAQETKVLLEKHRKFVDVAQSTYDYGRQLLQATVVLCQSLRCTSRSSGDTLPRL
NRVWKQFTVASEERVHRLEMAIAFHSNAEKILQDCPEEPEAINDEEQFDEVEAVGKSLLD
RLTVPVVYPDGTEQYFGSPSDMASTAEHIRDRMKLVSLKRQQLRHPEMMTTES
Download sequence
Identical sequences F1N429
ENSBTAP00000038429 ENSBTAP00000038429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]