SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000038655 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000038655
Domain Number 1 Region: 907-959
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.82e-16
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 2 Region: 217-267
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000616
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 3 Region: 880-915
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000431
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 4 Region: 151-203
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000209
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Domain Number 5 Region: 574-619
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000855
Family Homeodomain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000038655   Gene: ENSBTAG00000020053   Transcript: ENSBTAT00000038847
Sequence length 1107
Comment pep:known chromosome:UMD3.1:13:34063175:34261299:-1 gene:ENSBTAG00000020053 transcript:ENSBTAT00000038847 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TNYNTVVETNSDSDDEDKLHIVEEESITDAADCEGGVPDDDLPSDQTVLPGSSAREGSAK
SCWEDDAGKEGQEILGPEARADEVGCAVKDDECDSDAENEQNHDPNVEEFLQQQDTAVIY
PEAPEDDQRQGTPEASGHDENGTPDAFSQLLTCPYCDRGYKRFTSLKEHIKYRHEKNEDN
FSCSLCSYTFAYRTQLERHMTSHKSGREQRHVTQSGGNRKFKCTECGKAFKYKHHLKEHL
RIHSGEKPYECPNCKKRFSHSGSYSSHISSKKCISLMPVNGRPRTGLKTSQCSSPSLSAS
PGSPTRPQMRQKIENKPLQEQLPVNQIKTEPVDYEFKPIVVASGINCSAPLQNGVFSGGG
PLQATSSPQGVVQAVVLPTVGLVSPISINLSDIQNVLKVAVDGNVIRQVLENNQANLASK
EQETINASSIQQGGHSVISAISLPLVDQDGTTKIIINYSLEQPSQLQVVPQNLKKETPVP
TTNCKSEKLPEDLTVKSEKDKSFEGGGNDSTCLLCDDCPGDLNALPELKHYDLKQPAQPP
PPPTPEAAKPEAAASSGSGDGSLSPSQPPLKNLLSLLKAYYALNAQPSAEELSKIADSVN
LPLDVVKKWFEKMQAGQISVQSSEPSSPEPGKANTPAKSNDQPQAADADEAQDSTGNRQS
PLKRASSPVLPGGSAVNGSRSSASSPSPLNLSSSRSAQGYSYPTEGAQEEPQVEPLDLSL
PKQQGELLERPTITSVYQNSVYSVQEEPLNLSCAKKEPQKDSCVTDSEPVVNVIPPSANP
INIAIPTVTAQLPTIVAIADQNSVPCLRALAANKQTILIPQVAYTYSTAVSPAVQETPLK
VIQPSGNQDERQDTSSEGVSNVEDQNDSDSTPPKKKMRKTENGMYACDLCDKIFQKSSSL
LRHKYEHTGKRPHECGICKKAFKHKHHLIEHMRLHSGEKPYQCDKCGKRFSHSGSYSQHM
NHRYSYCKREAEEREPPEPGAAGPGVPPEQHAGQGDSDERESSTREEDEDSEKEEEEEEE
ERELEELEEEKGSGAARGAEEVEEEVEDGEEEMDDEEDEDEEAEDDGERAETEGVGQGAG
AGGQAHSLEHKVSEGSEQVSEEKTNEA
Download sequence
Identical sequences F1N264
ENSBTAP00000038655 ENSBTAP00000038655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]