SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000038767 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000038767
Domain Number 1 Region: 1-187
Classification Level Classification E-value
Superfamily EF-hand 1.43e-35
Family Calmodulin-like 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000038767   Gene: ENSBTAG00000027173   Transcript: ENSBTAT00000038963
Sequence length 195
Comment pep:known chromosome:UMD3.1:10:36835140:36872289:1 gene:ENSBTAG00000027173 transcript:ENSBTAT00000038963 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAIN
PLGDRIINAFFPEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFR
LYDLDKDDKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVL
EKVDVEQKMSIRFLH
Download sequence
Identical sequences A0A091ECA4 A0A1S3AKJ3 A0A286XGD5 A0A2I2V0W7 A0A2K5CMT0 A0A2K5PZF3 A0A2K6G215 A0A2K6U9H9 E2RPH3 F6XSG1 F7CLX6 F7FW81 G1MEF2 G1NVP0 G3TDR7 G3WW99 G5BM10 H0X8D0 I3MN18 L5K1F7 M3YBP1 Q3SYS6 U3DI06 U6CRT2 W5QGJ2
ENSOANP00000007131 ENSECAP00000017232 ENSBTAP00000038767 ENSTTRP00000009322 ENSOGAP00000011734 ENSTTRP00000009322 ENSPVAP00000002971 ENSCAFP00000014010 ENSSARP00000008660 ENSOANP00000007131 ENSMODP00000000182 ENSCAFP00000014010 ENSECAP00000017232 ENSMLUP00000001348 ENSOPRP00000015018 ENSOARP00000021841 ENSSTOP00000012990 NP_001069044.1.59421 NP_001069044.1.76553 XP_001370994.1.35504 XP_001503522.1.31192 XP_001520469.2.37387 XP_002913257.1.58354 XP_003418713.1.64505 XP_003475752.1.53824 XP_003756043.1.9362 XP_003791783.1.62490 XP_003935745.1.74449 XP_003987313.1.62641 XP_004010508.1.66739 XP_004010509.1.66739 XP_004274025.1.21590 XP_004325239.1.83887 XP_004380703.1.4749 XP_004400472.1.74151 XP_004421493.1.5094 XP_004481576.1.11602 XP_004578220.1.84141 XP_004609641.1.94378 XP_004687959.1.23501 XP_004712780.1.18182 XP_004751185.1.14098 XP_004861653.1.39548 XP_005685560.1.57651 XP_005860320.1.60319 XP_006066306.1.26621 XP_006093099.1.53796 XP_006158736.1.99106 XP_006176694.1.101512 XP_006201732.1.17985 XP_006736703.1.47382 XP_006778138.1.95426 XP_006831817.1.41390 XP_006883059.1.29581 XP_006920536.1.64745 XP_007081739.1.5354 XP_007111764.1.24612 XP_007460219.1.90284 XP_007536389.1.11023 XP_007938618.1.48129 XP_008141243.1.99482 XP_008538110.1.77740 XP_008585914.1.73410 XP_008700452.1.72690 XP_010623017.1.5607 XP_010846284.1.44457 XP_010963467.1.22495 XP_010987598.1.51371 XP_011353242.1.92234 XP_011987392.1.54773 XP_011987393.1.54773 XP_012317881.1.9421 XP_012504955.1.63892 XP_012621911.1.48125 XP_013215030.1.77405 XP_013367938.1.28644 XP_013965029.1.84170 XP_014712852.1.49734 XP_014920398.1.86478 XP_015336290.1.40921 XP_016007749.1.101085 XP_016075921.1.3490 XP_017386477.1.71028 XP_017536612.1.32401 XP_019298059.1.44245 XP_019500545.1.44202 XP_019581014.1.88060 XP_019824119.1.53367 XP_020733247.1.74333 XP_020864895.1.61212 XP_021550987.1.83697 ENSMODP00000000182 ENSCPOP00000009497 ENSSHAP00000019704 ENSLAFP00000012342 ENSMPUP00000008748 ENSLAFP00000012342 ENSSHAP00000019704 ENSMPUP00000008748 ENSMLUP00000001348 ENSFCAP00000005898 10141.ENSCPOP00000009497 13616.ENSMODP00000000182 9258.ENSOANP00000007131 9615.ENSCAFP00000014010 9796.ENSECAP00000017232 9913.ENSBTAP00000038767 ENSCPOP00000009497 ENSSTOP00000012990 ENSAMEP00000017730 ENSSARP00000008660 ENSAMEP00000017730 HGL_H00000376328-2 ENSOPRP00000015018 ENSBTAP00000038767 ENSOGAP00000011734 ENSPVAP00000002971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]