SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000039071 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000039071
Domain Number 1 Region: 5-141
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.67e-40
Family Dual specificity phosphatase-like 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000039071   Gene: ENSBTAG00000027375   Transcript: ENSBTAT00000039272
Sequence length 205
Comment pep:known chromosome:UMD3.1:23:52099150:52135349:-1 gene:ENSBTAG00000027375 transcript:ENSBTAT00000039272 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGEGLNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPS
QNLTRHFKESIKFIHECRLQGEGCLVHCLAGVSRSVTLVVAYIMTVTDFGWEDALHTVRA
GRSCANPNLGFQRQLQEFEELQVHQFRQWLREEYGESPLRDAEEARSILGKYKEQGRAEP
PPGARRWAGLRAPPPLAYGSYTPET
Download sequence
Identical sequences F1MPX5
ENSBTAP00000039071 ENSBTAP00000039071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]