SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000039405 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000039405
Domain Number 1 Region: 276-326
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.07e-18
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 2 Region: 316-373
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000168
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 234-286
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000039
Family Classic zinc finger, C2H2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000039405   Gene: ENSBTAG00000019359   Transcript: ENSBTAT00000039615
Sequence length 889
Comment pep:known chromosome:UMD3.1:6:73986000:73997338:1 gene:ENSBTAG00000019359 transcript:ENSBTAT00000039615 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGGLFTGSGTMGMALPNDMYDLPDLSRAELAAPQLIMLANVALTGEVNGGCCDYLVGEER
QMAELMPVGDSNFSDSDGEGLEESPEVKGEPSGLENMELESLELSVVQPRPVFEVAAASE
TYSSNKDVPQETPVAEDKCKNLKTKPFRCKPCQYEAESEEQFVHHIRVHSAKKFFVEESA
EKQAKARESGSSTGEEGDFSKGPIRCDRCGYNTNRYDHYTAHLKHHTRAGDNERVYKCII
CTYTTVSEYHWRKHLRNHFPRKVYTCGKCNYFSDRKNNYVQHVRTHTGERPYKCELCPYS
SSQKTHLTRHMRTHSGEKPFKCDQCSYVASNQHEVTRHARQVHNGPKPLNCPHCDYKTAD
RSNFKKHVELHVNPRQFNCPVCDYAASKKCNLQYHFKSKHPTCPNKTMDVSKVKLKKTKK
READLPDNKLTSEKTETEQTKGKGDVTGKKNERSVKAEKKDNVSKEKKPCSNASSQVTTR
TRKSAMEGKEVDVSPGNCSEKSCKSKKSKRKVEAEALPLQEPVNDEEPVTKKKRKAESKS
KNSQEVPKGDSKVEENKKQNICVKNSTKKKTVRSKSCKKSSQPAQRRPTQMESAQKGPVP
MEPSPPMEPSPPMEPVQVTPVEMEPSPPLPPPPPEPAQVGSVQVEPPPPPPPVGDAEIEV
VRKGPVETEPPPPMEPIPRRSPRKDNRKEKSSMLSEMAREGNEEAPLQKVEAEEAENLNM
PEGETSEDKHQAEAMLCEMEMDTDEKKAENFPSRDSAVEEPVSPPLSALPLEKHEAVSTT
AVASPPVTVAVNESQEMDEDEGIHSHDGSDLSDNTSEDSDDSGLNGARPVPQETSGKDGK
DALAVKVAAGDFVCIFCDRSFRKEKDYSKHLNRHLVNVYFLEKAAQGQE
Download sequence
Identical sequences E1BCT1
ENSBTAP00000039405 ENSBTAP00000039405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]