SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000039575 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000039575
Domain Number 1 Region: 51-163
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 2.49e-38
Family Frizzled cysteine-rich domain 0.0000996
Further Details:      
 
Domain Number 2 Region: 178-302
Classification Level Classification E-value
Superfamily TIMP-like 2.35e-20
Family Netrin-like domain (NTR/C345C module) 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000039575   Gene: ENSBTAG00000027625   Transcript: ENSBTAT00000039787
Sequence length 308
Comment pep:known chromosome:UMD3.1:27:35900362:35943920:-1 gene:ENSBTAG00000027625 transcript:ENSBTAT00000039787 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGGRWAAAGALLALAAGLLAAGSASECDYVSFQSDIGAYQSGRFYTKPPQCVDIPADLR
LCHNVGYKRMVLPNLLEHETMAEVKQQASSWVPLLNKNCHIGTQVFLCSLFAPVCLDRPI
YPCRWLCEAVRDSCEPVMQFFGFYWPEMLKCDKFPEGDVCIAMTPPNATEASKPQGTTVC
PPCDNELKSEAIIEHLCASEFALRMKIKEVKKENGDKKIVPKKKKPLKLGPIKKKELKKL
VLYLKNGADCPCHQLDNLSHHFLIMGRKVKSQYLLTAIHKWDKKNKEFKTFMKKMKNHEC
PTFQSVFK
Download sequence
Identical sequences F1MDU5
ENSBTAP00000039575 ENSBTAP00000039575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]