SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000040066 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000040066
Domain Number 1 Region: 138-309
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 9.68e-46
Family Ypt/Rab-GAP domain of gyp1p 0.0071
Further Details:      
 
Domain Number 2 Region: 287-405
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 9.94e-33
Family Ypt/Rab-GAP domain of gyp1p 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000040066   Gene: ENSBTAG00000011363   Transcript: ENSBTAT00000040289
Sequence length 821
Comment pep:known chromosome:UMD3.1:3:50905459:51074025:1 gene:ENSBTAG00000011363 transcript:ENSBTAT00000040289 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SFLGILPSTIRTPSSHSMVATDKVAEKLSSTLSWVKNTVSHTVSQMASQVASPSASLHTT
SSSTTLSTPALSPSSPSQLSPDDLELLAKLEEQNRLLETDSKSLRSVNGSRRNSGSSLVS
SSSASSNLSHLEEDSWILWGRVVNEWEDVRKKKEKQVKELVRKGIPHHFRAIVWQLLCSA
QSMPIKDQYSELLKMTSPCEKLIRRDIARTYPEHNFFKEKDSLGQEVLFNVMKAYSLVDR
EVGYCQGSAFIVGLLLMQMPEEEAFCVFVKLMQDYRLRELFKPSMAELGLCMYQFECMIQ
EHLPELFVHFQSQSFHTSMYASSWFLTIFLTTFPLPIATRIFDIFMSEGLEIVFRVGLAL
LQMNQAELMQLDMEGMLQHFQKVIPHQFDGGPDKLIQAAYQVKYNSKKMKKLEKEYTTIK
TKEMEEQVEIKRLRTENRLLKQRIETLEKESASLADRLIQHKCSSNYNEDFVLQLEKELV
QARLSEAESQCALKEMQDKVLDIEKRNNSFPDENNIARLQEELIAVKLREAEAIMGLKEL
RQQVKDLEEHWQRHLARTTGRWKDPPKKNAMIELQDELMTIRLREAETQAEIREIKQRMM
EMETQNQINSNHLRRAEQEVINLQEKVQYLSAQNKGLLTQLSEAKRKQAEIECKNKEEVM
AVRLREADSIAAVAELQQHIAELEIQKEEGKLQGQLNKSDSNQYIRELKDQIAELNHELR
CLKGQRGFSSQPPFDGIHIVNHLIGDDESFHSSDEEFIDNSLQESGIGFPLHRKSGPMSL
DPTLADGSESEAEDSVLETRDGSRVAQKEQPLRRASYSTTV
Download sequence
Identical sequences F1MRM9
ENSBTAP00000040066 ENSBTAP00000040066

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]