SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000040726 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000040726
Domain Number 1 Region: 473-522
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000242
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 2 Region: 129-182
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000438
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 3 Region: 217-238,372-399
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000153
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000040726   Gene: ENSBTAG00000030556   Transcript: ENSBTAT00000043137
Sequence length 1003
Comment pep:known chromosome:UMD3.1:13:81854047:81863004:-1 gene:ENSBTAG00000030556 transcript:ENSBTAT00000043137 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YNPQETGNMPTQSLLVYMDGPEVIGNSLGTQMELDDAMTIKGAAAVPFRAAQEKSITQME
GCMPLDCMFCSQSFTRSEDLSKHVLLQHRPTLCEPAVLRVEAEYLSPLDKVQVRSEPPKD
KSCKENEELSCEVCGQTFRVAFDVEIHMKKHKDSFTYGCHMCGRRFKEPWFLKNHMRTHT
GKSGAKSRLQPGLESPATINEVVQEPAAEGVSSPYKICMVCGFLFPNKESLIDHRKMHTK
EAASGPRGPQIEAPQEGMLSPGAELLQFLNLRPTSPAEIAKKPAKWIPQLDPFTTYQAWQ
LATKGKVAVCREVKEQQPGQEGSTDNDESCSDKEEPGTSKSGCPGLSQDKEKSRHPHGEV
PSVDADPKLASSKDKPTHCAECGKAFRTYHQLVLHSRVHKKERRPDAGSPPTAADGRQPR
TCSPELPPALEDSGALDREAGSEDGSEDGLPDGLHLDKNDDGGKMKHLTSSRECSYCGKF
FRSNYYLNIHLRTHTGEKPYKCEFCDYAAAQKTSLRYHLERHHRDKQTDAAADAKSDGRP
PEAEDALLTADGAQTKNLKRCFDGAKDVKGSPPAKQLKGMAPASQSVLGGAVLAPVHRET
QDFSKDAADDGAEKLSKAPGPAYLDALKKRPPADPQASPLVCRTEAATAARHAQLGPREK
RAADAGWQEKPLNLSLAPHGGAGAPLGRSVTASSTCPLCTFKTFYPEVLTMHQRLEHKYH
PDALESCRGRAALRSRRTGCPPALLGKDVPPLPGAFRPKPRPAAPEQPKPAPAERPAPGA
PGPSRAPPPPPPAGADSTLAPSNLKALRPLPPPGLGVSGPGPARTPPEAPPCKAGPEKVR
RPEPQPPADAARSDGPWVPTRDYACGRGGAEPGEPLPKRPRVPPEPPCAPCRRPPELPQY
RVVRGLASLLPPECACAPPAPPARPRPAPGPAFAALLPCAPAAALEGGRPRGALEGRGGP
WSSGPFSGKRPVSYQHLSSSMLQKRNYENFIGNAHYRPNDKKT
Download sequence
Identical sequences E1BN65
ENSBTAP00000040726 ENSBTAP00000040726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]