SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000040783 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000040783
Domain Number 1 Region: 58-217,245-263
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 4.45e-33
Family Ypt/Rab-GAP domain of gyp1p 0.002
Further Details:      
 
Domain Number 2 Region: 301-412
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 7.85e-32
Family Ypt/Rab-GAP domain of gyp1p 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000040783   Gene: ENSBTAG00000030581   Transcript: ENSBTAT00000043194
Sequence length 804
Comment pep:known chromosome:UMD3.1:1:155833805:156108988:-1 gene:ENSBTAG00000030581 transcript:ENSBTAT00000043194 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KLLSRTNKPNLVQDAENVGLLPLFKLSNWFGTTLLSKQKDFNKRIPTLWFLASRKEWEEL
FVNNNYLATIRQKGINGQLRSSRFRSICWKLFLCVLPQDKSQWISKIKELRAWYSSVKEI
HITNPRKAVGQQDLMINNPLSQDEGSLWNKFFQDKELRSMIEQDVKRTFPEMQFFQQESV
RKILTDVLFCYARENEQLLYKQGMHELLAPIVFTLHCDHQAFLHASESAQPSEEMKTLLN
PEYLEHDAYAMFSQLMETAEPWFSTFEHDGQKGKETLMPPIPFARPQDLGPTIAIVTKVN
QIQDQLLKKHDIELYMHLNRLEIAPQIYGLRWVRLLFGREFPLQDLLVVWDALFADGLTL
TLVDYVFVAMLLYIRDALISSNYQTCLGLLMHYPLIGDVHSLILKALFLRDPKRNPRPVT
YQFHPNLDYYKARGADLMNKSRTNAKGAPLNINKVSNSLINFGRKLISPAAAPGGAGGPV
AAGGAGAPSPAAAPTRTLAEAPRHALQQQQQRLMKSESMPVQLNKGNPGDVVTGSDAQVS
VPVQTLTDLPGQSSKNISSSPSIESLPGGREFTGSPPSSAAKKDSFFSNISRSRSHSKTM
GRRESEEELEAQISFLQGQLNDLDAMCKYCAKVMDTHLVNIQEVILQENLEKEDQILVSL
AGLKQIKDILKGSLRFNQSQLEAEDNEQISISDDHYCSSGAAQQVPGSQGGAPPAAPGRR
ERPGADDFVLVSKDCEERGAGLSPAGQAQPLRPLRGAARPVLVFSDPLTGPASASSSNPS
SSPDDDSSGHSKDSGFTIVSPLDL
Download sequence
Identical sequences F1N3C5
ENSBTAP00000040783 ENSBTAP00000040783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]