SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000040894 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000040894
Domain Number 1 Region: 8-160
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 2.1e-40
Family Multidomain sulfurtransferase (rhodanese) 0.000000177
Further Details:      
 
Domain Number 2 Region: 152-285
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 3.14e-32
Family Multidomain sulfurtransferase (rhodanese) 0.000000232
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000040894   Gene: ENSBTAG00000030650   Transcript: ENSBTAT00000043317
Sequence length 297
Comment pep:known chromosome:UMD3.1:5:75810521:75817101:-1 gene:ENSBTAG00000030650 transcript:ENSBTAT00000043317 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVHQVLYRALVSTKWLAESVRAGKVGPGLRVLDASWYSPGTREARKEYLERHVPGASFFD
IEECRDKASPYEVMLPSEAGFADYVGSLGISNDTHVVVYDGDDLGSFYAPRVWWMFRVFG
HRTVSVLNGGFRNWLKEGHPVTSEPSRPEPAIFKATLNRSLLKTYEQVLENLESKRFQLV
DSRAQGRYLGTQPEPDAVGLDSGHIRGSVNMPFMNFLTEDGFEKSPEELRAMFEAKKVDL
TKPLIATCRKGVTACHIALAAYLCGKPDVAIYDGSWFEWFHRAPPETWVSQGKGGKA
Download sequence
Identical sequences P00586
ENSBTAP00000040894 9913.ENSBTAP00000040894 9913.ENSBTAP00000047127 NP_803455.1.59421 NP_803455.1.76553 ENSBTAP00000040894

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]