SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000040937 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000040937
Domain Number 1 Region: 9-124
Classification Level Classification E-value
Superfamily POZ domain 4.24e-23
Family BTB/POZ domain 0.0025
Further Details:      
 
Domain Number 2 Region: 348-400
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000133
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 3 Region: 310-363
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000512
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000040937   Gene: ENSBTAG00000039815   Transcript: ENSBTAT00000043362
Sequence length 424
Comment pep:known chromosome:UMD3.1:11:94072877:94074965:-1 gene:ENSBTAG00000039815 transcript:ENSBTAT00000043362 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAESDVLHFQFEQQGDVVLQKMNLLRQQNLFCDVSIYINDTEFQGHKVILAACSTFMRD
QFLLTQSKHVRITILQSAEVGRKLLLSCYTGALEVKRKELLKYLTAASYLQMVHIVEKCT
EALSKYLEIDLSMKNNNQHVDLCQSSDRDVKNEDENSDKDCEIIEISEDSPVNIDFHVKE
EESNVLQSTVESLTTEREEMRSPELSSVDMSFKDNEIRILHVESISTGGVENGKFSQPCT
SSKASMYFSETQHSLINSTVESRVAEVPGNQDQGLFCENTEGSHGPVNEIQNLEDAFSLR
HQCPRCPRGFLHVENYLRHLKMHKLFLCLQCGKTFTQKKNLNRHIRGHMGIRPFQCTVCL
KTFTAKSTLQDHLNIHSGDRPYKCHCCDMDFKHKSALKKHLTSLHGRSSGEKLPRHDLER
QNLL
Download sequence
Identical sequences Q0V8G8
NP_001069675.1.59421 NP_001069675.1.76553 XP_005213205.1.76553 XP_019826342.1.53367 9913.ENSBTAP00000040937 ENSBTAP00000040937 ENSBTAP00000040937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]