SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000040938 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000040938
Domain Number 1 Region: 17-137
Classification Level Classification E-value
Superfamily POZ domain 8.63e-23
Family BTB/POZ domain 0.0029
Further Details:      
 
Domain Number 2 Region: 307-355
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000041
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 3 Region: 345-389
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000121
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000040938
Domain Number - Region: 283-318
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0345
Family Classic zinc finger, C2H2 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000040938   Gene: ENSBTAG00000038610   Transcript: ENSBTAT00000043363
Sequence length 452
Comment pep:known chromosome:UMD3.1:11:94081312:94082670:-1 gene:ENSBTAG00000038610 transcript:ENSBTAT00000043363 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFTFLFFRSAKMSERSDLLHFKFENYGDSMLQKMNKLREENKFCDVTVLIDDIEVQGHKI
VFAAGSPFLRDQFLLNDSREVKISILQSSEVGRQLLLSCYSGVLEFPEMELVNYLTAASF
LQMSHIVERCTQALWKFIKPKQPMESKEGCEPQSASPQSKEHQGDARGSPKQDSPCIHPS
EDSMDIEDSDIQIVKVESIGDVSEVRSKKDQNQFISSEPTALHSSEPQHSLINSTVENRV
SEIEQNHLHNYALSYTGSDNIIMAAKDVFGPNIRGVDKGLQWHHQCPKCTRVFRHLENYA
NHLKMHKLFMCLLCGKTFTQKGNLHRHMRVHAGIKPFQCKICGKTFSQKCSLQDHLNLHS
GDKPHKCNYCDMVFAHKPVLRKHLKQLHGKNSFDNANERNVQDLTVDFDSFACTTVTDSK
GCQPQPDATQVLDAGKLAQAVLNLRNDSTCVN
Download sequence
Identical sequences F1N2M3 W5QCY0
ENSBTAP00000040938 ENSBTAP00000040938 ENSOARP00000020578 9913.ENSBTAP00000040938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]