SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000041248 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000041248
Domain Number 1 Region: 324-368
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000384
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 2 Region: 357-393
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000616
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000041248   Gene: ENSBTAG00000008313   Transcript: ENSBTAT00000043695
Sequence length 403
Comment pep:known chromosome:UMD3.1:22:61283172:61292866:1 gene:ENSBTAG00000008313 transcript:ENSBTAT00000043695 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDHLLPVDETFSSLKRPICFLGDGRAYHMLPSPLSEDDSDASSLCSCASPDSQTLCSCY
GGGRGAEGQDSILDFLLSQATLGSGVAAHGSPMAWGTWRKTPAPVKGEHFSFPEFPVGNP
DDVPRPFQPTLEEIEEFLEENMEPAVKQAPEGSGKDLDTCGQLSTGPHRGHLHPGASGRE
RCAPPPGAGAAGSQGPAGAPAPDPPVPLLLQIQPVPVKQESGAEPASPGQPPEAVRVAQL
LVSIQGQTFTLVPQVLPSSSLSLPSKFVRIAPVPIAAKPLGSGPLGPGSTGLLVGQKFPK
NPAAELIKMHRCTFPGCSKMYTKSSHLKAHLRRHTGEKPFACTWPGCGWRFSRSDELSRH
RRSHSGVKPYQCPVCEKKFARSDHLSKHVKVHRFPRSSRLPRP
Download sequence
Identical sequences A6QL89
XP_010816297.1.76553 9913.ENSBTAP00000041248 ENSBTAP00000041248 ENSBTAP00000041248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]