SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000041262 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000041262
Domain Number 1 Region: 20-126
Classification Level Classification E-value
Superfamily POZ domain 6.67e-22
Family BTB/POZ domain 0.0028
Further Details:      
 
Domain Number 2 Region: 514-566
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.12e-17
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 3 Region: 621-672
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000533
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 
Domain Number 4 Region: 551-603
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000817
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 5 Region: 311-370
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000001
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 
Domain Number 6 Region: 471-523
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000093
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 7 Region: 417-464
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000217
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number 8 Region: 658-701
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000354
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000041262   Gene: ENSBTAG00000002291   Transcript: ENSBTAT00000043711
Sequence length 863
Comment pep:known chromosome:UMD3.1:16:78008531:78041752:-1 gene:ENSBTAG00000002291 transcript:ENSBTAT00000043711 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRCYQELPPSPDQRKLLSSLQYNKNLLKYLNDDRQKQPSFCDLLIIVEGKEFSAHKVVVA
VGSSYFHACLSKNPSTDVVTLDHVTHSVFQHLLEFLYTSEFFVYKYEIPLVLEAAKFLDI
IDAVKLLNNENVATFQSELTEKSSPEETLSELTGRLSSNHQCKFCSRHFCYKKSLENHLS
KTHRSLLLGKKHGLKMLERSFSTRRSKRNRKCPVKFEDTSDDEQESGDGSDNLNQDSFDK
EKSDRNDSEDPGSEYNAEEDELEEEMSDEYSDTEEQSEKDQNDAEEEPEAGDSVGSIHEG
LTPVIIQNSNKKILQCPKCDKTFDRIGKYESHTRVHTGEKPFECDICHQRYSTKSNLTVH
RKKHSNETEFHKKEHKCPYCNKLHASKKTLAKHVKSRFHPENAQEFISIKKTKSESWKCD
ICKKSFTRRPHLEEHMILHSQDKPFKCTYCEEHFKSRFARLKHQEKFHLGPFPCDICGRQ
FNDTGNLKRHIECTHGGKRKWTCFICGKSVRERTTLKEHLRIHSGEKPHLCSICGQSFRH
GSSYRLHLRVHHDDKRYECDECGKTFIRHDHLTKHKKIHSGEKAHQCEECGKCFGRRDHL
TVHYKSVHLGEKVWQKYKATFHQCDVCKKIFKGKSSLEMHFRTHSGEKPYKCQICNQSFR
IKKTLTKHLVIHSDARPFNCQHCNATFKRKDKLKYHIDHVHGIKSPDDPLSASEEKLVSL
PVEYSSDDKIFQTETKQYMEQPKVYQSEAKTMLQNVSAEVCVPVTLVPVQMPDTQGDLVR
HTTTLPPPAHEILSPQPPATDYPRAADLAFLEKYTLTPQPANIVHPVRPEQMLDPREQSY
LGTLLGLDNSTAVQNISNSEHHS
Download sequence
Identical sequences F1MLT2
ENSBTAP00000041262 ENSBTAP00000041262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]