SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000041291 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000041291
Domain Number 1 Region: 485-541
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.89e-25
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 317-373
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.85e-24
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 3 Region: 429-485
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.95e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 4 Region: 569-625
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.02e-23
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 5 Region: 373-429
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.27e-23
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 6 Region: 614-666
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4e-22
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 7 Region: 3-63
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.31e-20
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 8 Region: 278-330
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.98e-17
Family Classic zinc finger, C2H2 0.0092
Further Details:      
 
Domain Number 9 Region: 164-222
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000553
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number 10 Region: 233-287
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000186
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 11 Region: 531-563
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000168
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000041291   Gene: ENSBTAG00000026263   Transcript: ENSBTAT00000043746
Sequence length 687
Comment pep:known chromosome:UMD3.1:18:52429558:52446106:1 gene:ENSBTAG00000026263 transcript:ENSBTAT00000043746 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKFKEAVTFKDVAVVFTEEEMGLLDLAQRKLYQEVMLENFRNLLSVGHQSFTPDVPSQL
EREEKLQMIRTAAQSCCSSGNQNLNGIETLQEVGLRYLPHEEFFCSKIWLQVTEELTRCR
DSMGIIQGIGSQLEKQSDTLYKDEFSKDFSQSSHLQVQRRDYTGGKPYKGVECGKGFIWG
SYLQMNRTASTGEKPYKCEKCENTFRRFSSLQAHQRVHSRAKLNNHDMSHKGFSQRSYLH
QHQRVPAGENPHRLEECGRNIRKSSHFQAPLIAHPLEKPYKCEECGLGYSKRSYLHVHQR
VHTEKKPYQCEECGKGFSWHSRLQAHQRIHTGEKPYKCDACGKGFSYSSHLNIHCRIHTG
EKPYKCEECGKGFSVGSHLQAHQISHTGEKPYKCEECGKGFCRASNLLDHQRGHSGEKPY
QCDACGKGFSRSSDFNIHFRVHTGEKPYKCEECGKGFSQASNLLAHQRGHTGEKPYKCGT
CGKGFSRSSDLNVHCRIHTGEKPYKCEKCGKAFSQFSSLQVHQRVHTGEKPYQCAECGKG
FSVGSQLQAHQRCHTGEKPYQCEECGKGFCRASNFLAHRGVHTGEKPYRCDVCGKRFRQR
SYLQAHQRVHTGEKPYKCEECGKVFSWSSYLQAHQRVHTGEKPYKCEECGKGFSWSSSLT
IHQRVHAGDEGDKDFASSENTYSKESL
Download sequence
Identical sequences F1MLR0
XP_010813378.1.76553 ENSBTAP00000041291 9913.ENSBTAP00000041291 ENSBTAP00000041291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]