SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000041316 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000041316
Domain Number 1 Region: 302-359
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.24e-25
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 2 Region: 38-100
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.42e-25
Family KRAB domain (Kruppel-associated box) 0.00074
Further Details:      
 
Domain Number 3 Region: 190-243
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.04e-22
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 4 Region: 246-303
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.76e-21
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 344-396
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.86e-20
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 6 Region: 153-204
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.3e-19
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000041316   Gene: ENSBTAG00000030929   Transcript: ENSBTAT00000043771
Sequence length 404
Comment pep:known chromosome:UMD3.1:7:17218711:17230346:1 gene:ENSBTAG00000030929 transcript:ENSBTAT00000043771 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATMVLSPTCAQSSLYTAPHQKGYAEKEGLARGFLTDWLQDLVTFEDVTVEFTQEEWALL
DSSQRKLYRDVMLENCRNLASLGIGYHVDKPSLISQLEQEDKVVTEEGGILPGTRPDLET
VLKAKWLTPKKPIFRKEHSNDVRAERSHLGVKLNECNQCFKVFSTKSNLTQHKRIHTGEK
PYDCNQCGKSFSSRSYLTIHKRIHNGEKPYECNDCGKAFNDPSSLRLHVRIHTGEKPYEC
NQCFHVFRTSCNLKSHKRIHTRENHHECNQCGKAFSTRSSLTGHNSIHTGEKPYECNDCG
KTFRKSSYLTQHMRTHTGEKPYECNQCGKSFSSSFSLTVHKRIHTGEKPYECSNCGKAFN
NLSAVKKHVRTHTGEKPYECNHCGKSFTTNSYLSVHKRIHNRWI
Download sequence
Identical sequences F1MQM2
ENSBTAP00000041316 ENSBTAP00000041316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]