SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000041334 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000041334
Domain Number 1 Region: 199-256
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.63e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 161-213
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000133
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 3 Region: 241-295
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000265
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 312-340
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000498
Family Classic zinc finger, C2H2 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000041334   Gene: ENSBTAG00000030939   Transcript: ENSBTAT00000043790
Sequence length 344
Comment pep:known chromosome:UMD3.1:18:52064957:52074914:1 gene:ENSBTAG00000030939 transcript:ENSBTAT00000043790 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PRSSTLTRIQQPQPQLLDQLGISLRCLQNRVDQNRLSGLSVPQKIQRSTSLLSPVELTSP
IRSLLHHHALCPSHMATAAEGGARSPAPRVLPLGFWASRMLERETESAAGGAEPSPTDKE
PVIKREAPDQGPPQKPSQSVPEPAASTGAPSRPRRRPPPQRPHRCPDCDKAFSYPSKLAT
HRLAHGGARPHPCPDCPKAFSYPSKLAAHRLTHSGARPHPCPHCPKAFGHRSKLAAHLWT
HAPTRPYPCPDCPKSFCYPSKLAAHRHTHHATDARPYPCPHCPKAFSFPSKLAAHRLCHD
PPTAPGSQATARHRCSSCSQAFGQRRLLLVHQRSHQPESPGERE
Download sequence
Identical sequences F6RY75
ENSBTAP00000041334 ENSBTAP00000041334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]