SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000041539 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000041539
Domain Number 1 Region: 1720-1772
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000106
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 2 Region: 1680-1735
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000302
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 3 Region: 1627-1675
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000598
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 598-650
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000252
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 639-690
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000442
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 6 Region: 1356-1408
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000857
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 7 Region: 360-409
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000454
Family Classic zinc finger, C2H2 0.033
Further Details:      
 
Domain Number 8 Region: 1582-1641
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000184
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 9 Region: 1752-1806
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000417
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number 10 Region: 399-461
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000436
Family Classic zinc finger, C2H2 0.077
Further Details:      
 
Domain Number 11 Region: 1419-1467
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000147
Family Classic zinc finger, C2H2 0.04
Further Details:      
 
Domain Number 12 Region: 1037-1088
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000171
Family Classic zinc finger, C2H2 0.029
Further Details:      
 
Domain Number 13 Region: 110-133,167-194
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000203
Family Classic zinc finger, C2H2 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000041539   Gene: ENSBTAG00000026772   Transcript: ENSBTAT00000044020
Sequence length 1848
Comment pep:known chromosome:UMD3.1:2:107322277:107338174:-1 gene:ENSBTAG00000026772 transcript:ENSBTAT00000044020 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EATAQKLVMMTDTVLDSQPANSTGEMDGLCPELLLIPPPLSNHGILEPVHSPCPGNPPPL
PPDPGCLLVEATATEEDTGNMEIIVEAVAGNLSPGAPGETPGVLVKVMEVYFCERCEQSF
AEPTLLALHQCTETLMQPVQGLPTPPCSVELPPSNLTLPSPLQGQSPPDSPLPCPVCRQE
FAQPQALKSHFKMHWGTPDTFSCPESGCVFSTEDRKELHQHLRLTHRALPVPCSFRGCPL
LFGSQQGMELHRQTHYPFHCNRCSFVGSNVKLFRQHQRSHGAGTQQELSAVMGLPSQELL
PVAAPKVPPGTGEPSEETGAPSPGQESVEEEEEERGSQKSSQKALELEGTVASGTESLFK
THMCPECKRCFKKRTHLVEHLHLHFPDPSLQCPNCQKFFTSKSKLKTHLLRELGQKAHRC
PLCHYSAVERNALNRHMASMHEDISNFYSDTYACPVCREEFRLSQALKEHLKSHTVAAAA
EPQPLCCFQEGCGHTAPDRKAFVKHLKETHGVRAVECRHHSCPMLFATVEAMEAHHKSHY
AFHCPHCDFACSNKHLFRKHKKQGHPGSEELRCTFCPFATFNPVAYQDHVGKMHAHEKIH
QCPECSFATAHKRVLIRHMLLHTGEKPHKCELCDFTCRDVSYLSKHMLTHSSTKDYMCTE
CGYVTKWKHYLSVHMRKHAGDLRYQCNQCSYRCHRADQLSSHKLRHQGKSLMCEVCAFAC
KRKYELQKHMASQHHPGTPVPLYPCRYCSYQSRHKQALLSHENCKHTRLREFRCALCDYR
TFSNTTLFFHKRKAHGYVPGDQVWQLRGASQEPEGARQCPTPSPDSEPASQPSAQPEGPD
HDPGAVIDPTLIQALPETSEEGSAGKQDSSEVPQGDDLVGSPSPAEVDEGSCTLHLEALG
VELGPVADPPLEEVTETAPVEFRPLDPPGPLSLEGPEGTLTDLSTFEGAGTSDLGAEEPI
LEKSGSQPPTNPPSSEEPLDGWVGTFKATTATETAPLPQLPESESLLKALRRQDKEQAEA
LVLEGRVQMVVIQAEGRAFRCPHCPFITRREKALSLHSRTGCQGRREPLLCPECGASFKQ
QRGLSTHLLKKCPVLLRKNKGLPRPDSPITLQPLPPSTAASEDAEGGKPPAAPLGEEIVL
PRDAPEPSREPEKIGEPLALLSGSTVPPVGDSLPSEAPEKFHFEQGKFHCNSCAFLCSRL
SSITSHVAEGCRGGRGWGGKRGAVQTQPALSPLSSGDSAPLSGGSTERSPGDGELALLPK
QKAARFSCPTCPFSCQQERALRTHQTRGCPLEPSGELRCGLCPFTAPAPAALKLHQKRRH
PAATPARGPRPPLQCGDCGFTCKQSRCLQQHRRLKHEGVKPHQCPFCDFSTTRRYRLEAH
QSRHTGVGRIRCNSCPQTFGTNSKLRLHRLRVHDKTPTHFCPLCDYSGYLRHDITRHVNS
CHQGTPAFACPQCEAQFSSETALKQHALRRHPEPTLPTPGSPAEATEGPLHCTRCGLLCA
SPASLRGHTRKQHPRLECGACQEAFPSRPALDEHRRQQHFSHRCQLCDFAARERVGLVKH
YLEQHETSEAAAASAGEGDSGQALLRCPFCDFACRHQLVLDHHVKGHGGTRLYKCTDCAY
STKNRQKITWHSRIHTGEKPYRCHLCPYACADPSRLKYHMRIHKEERKYLCPDCGYKCKW
VNQLKYHMTKHTGLKPYQCPECEYCTNRADALRVHQETRHREARAFMCEQCGKAFKTRFL
LRTHLRKHSEAKPYVCNVCHRAFRWAAGLRHHALTHTDRHPFFCRLCSYKAKQKFQVVKH
VRRHHPDQADPNQGVGKDPTTPTVHLHDVQLEDPGPPAPAAPPTGPEG
Download sequence
Identical sequences E1BNL0
ENSBTAP00000041539 ENSBTAP00000041539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]