SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000041846 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000041846
Domain Number 1 Region: 18-106
Classification Level Classification E-value
Superfamily POZ domain 1.67e-17
Family BTB/POZ domain 0.0016
Further Details:      
 
Domain Number 2 Region: 344-396
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.9e-16
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 3 Region: 323-352
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000285
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000041846   Gene: ENSBTAG00000005038   Transcript: ENSBTAT00000044341
Sequence length 410
Comment pep:known chromosome:UMD3.1:21:70903809:70905041:1 gene:ENSBTAG00000005038 transcript:ENSBTAT00000044341 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRQQRELASCATARARGRRALPAHRAVLAACSVYFHLFYRDQPSGSRDTVRLNGDIVTAP
AFGRLLDFMYEGRLDLRSLPVEDVLAAASYLHMYDIVKVCKNRLREKERALPPETPAPGA
EPPVRPPGPLSAWAPAPCPASLKARLPPAGPKATRPPPAPGPLPWQTPGESDGALDLSLK
PGPRRPPVRPPCALQTAPCRQKQPGAQPVVKEEPDSESEREDGSSSPRSAHSPLRPPGVT
AAEPLVGGLGPLPVRGVGSGAPGPEAERGELEAALRPSGRLCLCPLCGKLFPGAHVLQPH
LSAHFRERDGGRARLSPDGAAPTCPLCRKTFSCTYTLKRHERTHSGEKPYTCVQCGKSFQ
YSHNLSRHAVVHTREKPHACRWCERRFTQSGDLYRHVRKFHCGLVKSLLV
Download sequence
Identical sequences G3X7S0
ENSBTAP00000041846 ENSBTAP00000041846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]