SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000042051 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000042051
Domain Number 1 Region: 97-147
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.64e-16
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 2 Region: 1499-1548
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000171
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 3 Region: 664-713
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000283
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 4 Region: 1227-1252,1375-1402
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000181
Family Classic zinc finger, C2H2 0.033
Further Details:      
 
Domain Number 5 Region: 636-671
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000277
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 6 Region: 39-85
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000112
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number 7 Region: 748-803
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000349
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 8 Region: 307-339
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000467
Family Classic zinc finger, C2H2 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000042051   Gene: ENSBTAG00000005980   Transcript: ENSBTAT00000044565
Sequence length 1671
Comment pep:known chromosome:UMD3.1:23:47900595:47959504:-1 gene:ENSBTAG00000005980 transcript:ENSBTAT00000044565 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSSSPIGLEGSDLSSINTMMSAVMSVGKVTENGGSPQSVKSPTKPPGPNRIGRRNQETK
EEKSSYNCPLCEKVCTTQHQLTMHIRQHNTDTGGADHSCSICGKSLSSASSLDRHMLVHS
GERPYKCTVCGQSFTTNGNMHRHMKIHEKDPNSSPAAAPPSPLKRRRLSSKRKLSHDVES
EKEDPAPAKKMVEDGPLGDAERKAEEVSHCPLCFKEFVCKYGLETHLETHSDNPLRCDVC
CVTFRTHRGLLRHNALVHRQLPRDALGRPFIQNNPAIPAGFHDLGFTDFSCRKFPRISQA
WCETNLRRCISEQHRFVCDTCDKAFPMLSSLTLHKQTHVAANQSPDRLQARAPPGDDLDQ
KVFLAVLGLQHAEDVRPAPAEEPPPDDNQAIQLQALRCQLPQEPGCAGLLSLAPFDAAAL
GGALAVLPAASDSVKHLALQPFQDGFIIQPDSSIVEKPISGEPAIELADIQQILKMAAAA
SQKVGLPPLAKAPAAPLQAVFKHMPPLKPKPLAAPRTVVATSTPPPLVNTQQASPGCVSP
SLPPPPLKLLKGTAEAAPGAHLLPPKSGAQLFLQPPRLELPGQAEVKTQLEQDSLLEALL
PLSVEAKIKQEIAEGDLKAIVAGPGGKKAPAVRKVLYPCRFCSQVFAFSGVLRAHVRSHL
GISPYQCNICDYIAADKAALIRHLRTHSGERPYICKICHYPFTVKANCERHLRKKHLKAT
RKDIEKNIEYVTSSTPELVDTLCSPETVCRLCGEDLKHYRALRVHMRAHCGRGLGGCPKP
RKPFECKECSAAFSAKRNCIHHVLKQHLHVPERDIESYVLAADGLGPANTPAEAPGRTDE
GERKPLAAFLEPQNGFLPAGPAQPLPAHVAVKVEPANNLATDFNEPLDFSQKGLALIQVK
QENAAAFLSPSAPYDCSMEPIDLSIPKNFRRGDKDSAAPGEAKKPEQEPGSSEQASPGPP
ACPTLPATLGASGPLEKPGVPAAASSAASPLEAAALPLQGPVQLAVPLYSSALVNSSPLL
GSSTLGSPALLRPLRPKPPLLLPKPPVTEELPPLASIAQIISSVSSAPTLLKTKVADPGP
GGTSGTAAALDGIGGALPKATTDITSPKESSDSPPSANSPEAASPTEQGPAGLSKKRGRK
RGARSRARSSGGVDLDSSGEFASIEKMLATTDTNKFSPFLQSAEDDAQDEVAAAPADHNG
PSDEEQGSPPEDRLLRAKRNSYSNCFKPFPCQKCGAFFSTKSNCERHQLRKHDSQSDAEA
SAAGSEVLDLTARELPAPTPEGASEPSPAAAPAREDPPGGAQEEAEQVATEEDLHPEEED
AQPTEEEEGEEECAEEEPAEAADGPEEDTVSNKSLDLNLASTLMGFKLAEGEAGAQDHKH
TCHVCGKSFKFLTTLSRHRKAHDREEPGDESAPPREHEGPHPADPEPPAPEPPAEAEVTP
DAPAEKQSEAAEGPSDADADGDGEGPAEKRPLEKSDDDKKPKTDTPRSAASKADKRKKVC
SVCSKRFWSLQDLTRHMRSHTGERPYKCQTCERTFTLKHSLVRHQRVHQKARHAKRHGRD
SDREEHAEEDSESESAHSGAHPVSEGEGDAGLHASAHVALTRSRRESLAAKDAGRREERA
AARSPPEPAPQGDPGRESPAGLLQDLLELPGRRPAHPLLPTADSASLLGLE
Download sequence
Identical sequences E1BN44
ENSBTAP00000042051 ENSBTAP00000042051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]