SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000042135 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000042135
Domain Number 1 Region: 2-109
Classification Level Classification E-value
Superfamily POZ domain 1.45e-30
Family BTB/POZ domain 0.00039
Further Details:      
 
Domain Number 2 Region: 500-556
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.38e-22
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 3 Region: 556-612
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.02e-18
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 4 Region: 374-426
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.32e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 445-500
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000118
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 6 Region: 332-389
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000015
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 7 Region: 296-346
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000779
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 8 Region: 705-732
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000871
Family Classic zinc finger, C2H2 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000042135   Gene: ENSBTAG00000018730   Transcript: ENSBTAT00000044658
Sequence length 792
Comment pep:known chromosome:UMD3.1:16:52852315:52881022:1 gene:ENSBTAG00000018730 transcript:ENSBTAT00000044658 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFPQHSQHVLEQLNQQRQLGLLCDCTFVVDGVDFKAHKAVLAACSEYFKMLFVDQKDVV
HLDISNAAGLGQVLEFMYTAKLSLSSENVDDVLAVASFLQMQDIITACHALKSLAEPAAS
PGENMEASAAEVGDKRAKEEKAAATPLSELDPARSSPPTGPGREPKEERGGQAESTGSGA
EQTEKADAPREPVELKPDPTSGMAAAEAEAALSESSEQEMEVEPARKGEEREEEEGAAPA
VVKEEGPPLEKGEAPEESEESASTDSGQELGAEARGLRSGTYGDRTESKAYGSVIHKCED
CGKEFTHTGNFKRHIRIHTGEKPFSCRECSKAFSDPAACKAHEKTHSPLKPYGCEECGKS
YRLISLLNLHKKRHSGEARYRCEDCGKLFTTSGNLKRHQLVHSGEKPYQCDYCGRSFSDP
TSKMRHLETHDTDKEHKCPHCDKKFNQVGNLKAHLKIHIADGPLKCRECGKQFTTSGNLK
RHLRIHGEKPYVCVHCQRQFADPGALQRHVRIHTGEKPCQCVMCGKAFTQASSLIAHVRQ
HTGEKPYVCERCGKRFVQSSQLANHIRHHDNIRPHKCSVCSKAFVNVGDLSKHIIIHTGE
KPYLCDKCGRGFNRVDNLRSHVKTVHQGKAGIKILEPEEGGEVSVVTVDDMVTLATEALA
ATAVTQLTVVPVGAAVTADETEVLKAEISKAVKQVQEEDPNTHILYACDSCGDKFLDANS
LAQHVRIHTAQALVMFQTDADFYQQYGPGSTWPAGQVLQAGELVFRPRDGADGQPALAET
PPTAPECPPPAE
Download sequence
Identical sequences E1BDX4
ENSBTAP00000042135 ENSBTAP00000042135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]