SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000042160 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000042160
Domain Number 1 Region: 324-383
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000193
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 2 Region: 448-505
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000278
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 3 Region: 488-544
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000155
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 373-427
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000486
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 5 Region: 281-338
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000085
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000042160   Gene: ENSBTAG00000031523   Transcript: ENSBTAT00000044683
Sequence length 814
Comment pep:known chromosome:UMD3.1:X:102588097:102590541:-1 gene:ENSBTAG00000031523 transcript:ENSBTAT00000044683 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIPRLLPARGMRQTGGAGSPEGGGRIRGGANLRAGQAPARRLLLLRGPQDGGPGRRREE
ASAASSCPGPAPSPLALRPDHATGCGSGGGSGGDDFFLVLLDPVGGDVETAGAGQAAGPV
WREEAGLGPRLLGGESGANPEGRPALGPSCLSAIPAPVPALAPIPAPGLGPATAFAGTVT
IHNQNLLLSLENGILTLATPPPPAWAPGVAPAPQPRGLVAPQAGIPHAAESGDCPELPPD
LLLAERAEPAPAPAPKEEEEGPAAVESPRGPPGPGQGVLLYLCPEVQCGQTFAKKHQLKV
HLLTHSSSQGQRPFKCPLGGCGWTFTTSYKLKRHLQSHDKLRPFGCPAEGCGKSFTTVYN
LKAHMKGHEQENSFKCEVCEDTFPTQAKLSAHQRSHFEPERPYQCAFSGCKKTFITVSAL
FSHNRAHFREQELFSCSFPGCSKQYDKACRLKIHLRSHTGERPFLCDFEGCGWNFTSMSK
LLRHKRKHDDDRRFMCPVEGCGKSFTRAEHLKGHSITHLGTKPFVCPVEGCCARFSARSS
LYIHSKKHLQDVDTWKSRCPVATCNKLFTSKHSMKTHMAKRHNLRQDLLAQLEAANSLTP
SSELTSQGQSDLSDAELVSLFSDVPGNNSSAAVLDTALVNSGILTIDVASVNSTLAGNLP
ANNNNSLGQAVDPQALMATSDLPQSLDTSLFFGTTAAGFQQGPLDMDDVSSLSAGPLASL
SSLALKNSSQEPQALIPSSKLTVDTDALTPSSTLCENSVSELLPPTKTEWNVHPDSDFFA
QEEETQFGFSNPAGNHGSQKETDLITVTGSSFLV
Download sequence
Identical sequences G3X7S5
XP_005200846.1.59421 XP_005228334.1.76553 ENSBTAP00000042160 ENSBTAP00000042160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]