SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000042161 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000042161
Domain Number 1 Region: 496-552
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.24e-24
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 2 Region: 439-496
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.41e-23
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 3 Region: 299-356
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.27e-22
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 537-589
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.09e-21
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 10-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.15e-19
Family KRAB domain (Kruppel-associated box) 0.0019
Further Details:      
 
Domain Number 6 Region: 345-397
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.6e-18
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 7 Region: 264-313
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.47e-16
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 8 Region: 383-440
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000291
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000042161   Gene: ENSBTAG00000040169   Transcript: ENSBTAT00000044684
Sequence length 594
Comment pep:known chromosome:UMD3.1:18:65197726:65211381:1 gene:ENSBTAG00000040169 transcript:ENSBTAT00000044684 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVPALKDPGQSHVTFEDVAVYFSQEEWCLLDEAQIQLYLDVMLENFALVCMLGSWPGVG
DEETPFEQSKSAGVSQIGSPRTDSSAEKVQPCKICILVLRNILHLTEEQGTNSGQKANTC
GAHGKQFCFTADIQQHQKQHTRETLLQYIMGKLSFLKSCTIHASGSLSPYNEIGKEFVAN
LGVQPQAKNTRNQQNNSKECEVVFHSGKSHQSSGEGKKASSRTDILVQDERILTSEQSCE
FTGGTHQSNHVQHQKGHIRGRSSECTECGKSFGQRKYLRIHRRIHTGERPYQCKECDKSF
IYKNRFIGHQRIHTGERPYECTQCGKCFTHQSSFYVHQRIHTGERPYKCNECGKSFINNS
NFHRHQRIHKGERPYTCNVCGKSFITLAGIRYHQKVHNREELYKGSDYETSFNQMHHLSS
SRKIHTGEKPYECSECGKSFTASSSLWYHQRIHSGERPHECSECGKSFIVRLSLRNHQRV
HTEERPYKCSECGKCFTSSSSLLRHQRVHNGERPYECSECGKSFTASYGLRYHQRVHSGE
KPYECSECGKSFTASSSLRYHQRVHSGEKPYECSECGKSFTASYGLQYHQRVHH
Download sequence
Identical sequences F1N134
ENSBTAP00000042161 ENSBTAP00000042161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]