SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000042182 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000042182
Domain Number 1 Region: 9-348
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.12e-119
Family Calpain large subunit, catalytic domain (domain II) 0.0000000134
Further Details:      
 
Domain Number 2 Region: 357-534
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 7.32e-39
Family Calpain large subunit, middle domain (domain III) 0.0000501
Further Details:      
 
Domain Number 3 Region: 553-716
Classification Level Classification E-value
Superfamily EF-hand 8.79e-25
Family Penta-EF-hand proteins 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000042182   Gene: ENSBTAG00000013239   Transcript: ENSBTAT00000044705
Sequence length 721
Comment pep:known chromosome:UMD3.1:18:48743599:48755715:-1 gene:ENSBTAG00000013239 transcript:ENSBTAT00000044705 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACGSRRVTIQLVNEETGPETKGPKLFRGQNYKAIRAACLDEGILFQDPYFPAGPDALGY
DQLGPHSEKAKGVEWKRPHEFCTEPQFICEDMSRTDVCQGRLGNCWFLAAAASLTLYPRL
LSRVVPPGQGFQHGYAGVFHFQLWQFGHWVDVVVDDRLPVCKGKLMFVCSDQRNEFWAPL
LEKAYAKLHGSYEVMRGGHMNEAFVDFTGGVGEVLYLKKDTPNPPGIFSILRHALAKESL
VGATALSDRGEYRTEDGLVKGHAYSVTGTHKVSLGFTRVRLLRLRNPWGRVEWNGAWSDS
CPRWDALPTEWRDALLVKKEDGEFWMELLDFFRHFDTIQICSLSPEVLGPSPAGGGWHIH
TFQGRWVRGFNSGGSQPGAETFWTNPQFRLTLLEPDEEDEEEDGSLGCWGAAGARGPARG
ARTPKCTVLLSLIQRNQRRLRAQGLRYLTVGFHVFQIPEELLGLWDSPRSRAHLSGLLRA
DRSPFCARRDVSRRCRLRPGHYLVVPSAARAGDEADFTLRVFSERRHTAAEVDDVISADL
HALMVPYIPLELELQQLFQELAGEEEELGAPQLQILLSIALEPARAHAQTPREIGLRTCE
QLLQCFGHGGSLDLYHFQQLWGHLLEWQATFDKFDEDASGTMNSYELRLALNAAGFHLNN
QLTQALTSRYRDSRLRVDFERFVSCMAQLICVFRYCSQHLDGGEGVVCLTHRQWMQVATF
S
Download sequence
Identical sequences F1N121
ENSBTAP00000042182 NP_001179626.1.59421 NP_001179626.1.76553 ENSBTAP00000042182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]