SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000042247 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000042247
Domain Number 1 Region: 30-59
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000904
Family C2HC finger 0.0013
Further Details:      
 
Domain Number 2 Region: 1-27
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000452
Family C2HC finger 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000042247   Gene: ENSBTAG00000003653   Transcript: ENSBTAT00000044784
Sequence length 382
Comment pep:known chromosome:UMD3.1:6:107443332:107463870:1 gene:ENSBTAG00000003653 transcript:ENSBTAT00000044784 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVFFTCNACGESVKKVQVEKHVALCRNCECLSCIDCGKDFWGDDYKNHVKCISEDQKYGG
KGYEGKTHKGDVKQQAWIQKIHELIKRPNVSPKVRELLEQISGFDNVPRKRAKFQNWMKN
SLKVHNESILEQVWNIFSEASSSEPVGKGPDQQPPEPVTKPCAENNADVPSSKANSSTEE
PAEAKKNKRERKAERQKNTKKEKKELRLENHQEDAKSQKPKKRKAAQEAEQEAADGSSGT
KSQRKKSKAERAQDGAVDGGAKVGEQADAGPGKRKRKHSEVEANSKKKKIKPPENSEDGE
PENHEAPAKGKFNWKGTIKAVLKQAPDNEITIKKLRKKVLAQYYAVTNEHHKSEEELLVI
FNKKISKNPTLKLLKDKVKLVK
Download sequence
Identical sequences Q58DA3
9913.ENSBTAP00000004763 ENSBTAP00000042247 ENSBTAP00000004763 NP_001026939.1.59421 NP_001026939.1.76553 XP_005208310.1.76553 XP_019818651.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]