SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000042339 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000042339
Domain Number 1 Region: 2-112
Classification Level Classification E-value
Superfamily POZ domain 9.42e-29
Family BTB/POZ domain 0.00084
Further Details:      
 
Domain Number 2 Region: 395-451
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.91e-23
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 3 Region: 436-488
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.24e-18
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 337-395
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.27e-18
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 5 Region: 302-351
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.02e-16
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000042339   Gene: ENSBTAG00000013142   Transcript: ENSBTAT00000044888
Sequence length 581
Comment pep:known chromosome:UMD3.1:1:98377178:98392775:-1 gene:ENSBTAG00000013142 transcript:ENSBTAT00000044888 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQYSHHCEHLLERLNKQREAGFLCDCTIVIGEFQFKAHRNVLASFSEYFGAIYRSTSENN
VFLDQSQVKADGFQKLLEFIYTGTLNLDSWNVKEIHQAADYLKVEEVVTKCKIKMEDFAF
IANPSSTEISSITGNIELNQQTCLLTLRDYNSREKSEVSTDLVQANPKQGALAKKSSQTK
KKKKAFNSQKTGQNKTVQYPSDILENASVELFLDANKLSTPIIEQVAQRSNSELELTSVV
ENTFPAQDIVQTVTVKRKRGKSQPNCALKEHSMSNIASVKNSYELESSGEELDQRYSKAK
PMCNTCGKVFSEASSLRRHMRIHKGVKPYVCHLCGKAFTQCNQLKTHVRTHTGEKPYKCE
LCDKGFAQKCQLVFHSRMHHGEEKPYKCDVCNLQFATSSNLKIHARKHSGEKPYVCDRCG
QRFAQASTLTYHVRRHTGEKPYVCDTCGKAFAVSSSLITHSRKHTGERPFICELCGNSYT
DIKNLKKHKTKVHSGADKILDSSIEDHPLNEQDSIQKSPLSETLDVKPSDVTLPLTLPLG
AEDHHLLLPVADSQPPAPDALLRPAANGYSEPQLIFLQQLY
Download sequence
Identical sequences Q3B7N9
ENSBTAP00000042339 NP_001030501.1.59421 NP_001030501.1.76553 XP_005201752.1.76553 XP_005908220.1.15283 XP_006056025.1.26621 XP_019815358.1.53367 XP_019815364.1.53367 ENSBTAP00000042339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]