SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000042388 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000042388
Domain Number 1 Region: 1339-1651
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 8.57e-113
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000000117
Further Details:      
 
Domain Number 2 Region: 1615-1903
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 9.39e-103
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000000108
Further Details:      
 
Domain Number 3 Region: 318-512
Classification Level Classification E-value
Superfamily Fibronectin type III 1.56e-44
Family Fibronectin type III 0.00043
Further Details:      
 
Domain Number 4 Region: 510-707
Classification Level Classification E-value
Superfamily Fibronectin type III 1.61e-41
Family Fibronectin type III 0.0006
Further Details:      
 
Domain Number 5 Region: 705-895
Classification Level Classification E-value
Superfamily Fibronectin type III 4.85e-29
Family Fibronectin type III 0.0003
Further Details:      
 
Domain Number 6 Region: 31-133
Classification Level Classification E-value
Superfamily Immunoglobulin 5.12e-18
Family I set domains 0.0049
Further Details:      
 
Domain Number 7 Region: 900-1017
Classification Level Classification E-value
Superfamily Fibronectin type III 1.54e-17
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 8 Region: 135-227
Classification Level Classification E-value
Superfamily Immunoglobulin 3.63e-17
Family I set domains 0.022
Further Details:      
 
Domain Number 9 Region: 230-324
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000202
Family I set domains 0.01
Further Details:      
 
Domain Number 10 Region: 1015-1137,1198-1227
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000144
Family Fibronectin type III 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000042388   Gene: ENSBTAG00000018052   Transcript: ENSBTAT00000044949
Sequence length 1911
Comment pep:known chromosome:UMD3.1:7:20191965:20256722:1 gene:ENSBTAG00000018052 transcript:ENSBTAT00000044949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPAWGHGVASVIRPVGLLVVLLVGGCAAEEPPRFIKEPKDQIGVSGGVASFVCQATGDP
KPRVTWNKKGKKVNSQRFETIEFDGSAGAVLRIQPLRTPRDENVYECVAQNSVGEITVHA
KLTVLREDQLPPGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPSAS
NGRIKQLRSGALQIESSEETDQGKYECVATNSAGVRYSSPANLYVRVRRVAPRFSILPMS
HEIMPGGNVNITCVAVGSPMPYVKWMQGAEDLTPEDDMPVGRNVLELTDVKDSANYTCVA
MSSLGVIEAVAQITVKSLPKAPGTPVVTENTATSITITWDSGNPDPVSYYVIEYKSKSQD
GPYQIKEDITTTRYSIGGLSPNSEYEIWVSAVNSIGQGPPSESVVTRTGEQAPASAPRNV
QARMLSATTMIIQWEEPVEPNGLIRGYRIYYTMEPEHPVGNWQKHNVDDSLLTTVGSLLE
DETYTVRVLAFTSVGDGPLSDPIQVKTQQGVPGQPMNFRAEAKSETSIGLSWSPPRQESI
IKYELLYREGDHGREVARTFDPATAFVVDDLKPNTEYAFRLAARSPQGLGAFTSVVRQRT
LQSKPSAPPQDVKCVSTRSTAILVSWRPPPPDTHNGALVSYSVRYRPLGSEDPQPKEVNG
IPPTTTQILLEALDKWTEYRITAVAHTEVGPGPESSPVVVRTDEDVPSAPPRKVEAEALN
ATAIRVLWRSPAPGRQHGQIRGYQVHYVRMEGAEARGPPRIKDIMLADAQEMVITNLQPE
TAYSITVAAYTMKGDGARSKPKVVVTKGAVLGRPTLSVQQTPEGSLLARWEPPAGATEDE
VLGYRLQFGREDSSPLATLEFPPTEDHYTASGVHKGATYVFRLAARSRGGLGEEAAEVLS
IPEDTPRGHPQILEAAGNATAGTVLLRWLPPVPAERNGAIIKYTVAVREAGALGPAQETE
LPAAAEPGAENVLTLQGLKPDTAYDLQVRAHTRRGPGPYSPPVRYRTFLRDQVSPKNFKV
KMIMKTSVLLSWEFPDNYNSPTPYKIQYNGLTLDVDGRTTKKLITHLKPNTFYNFVLTNR
GSSLGGLQQTVTAWTAFNLLSSKPSVTPKPDSDGFIVVYLPDGQSPVPVQNYFIVMVPLR
KSRGGQFLTPLGSPEDMDLEELIQDIARLQRRSLRHSRQLEVPRPYIAARFSVLPHTFHP
GDQKQYGGFDNRGLEPGHRYVLFVLAVLQKSEPTFAASPFSDPFQLDNPDPQPIVDGEEG
LIWVIGPVLAVVFIICIVIAILLYKNLLAQSKRKDSEPRTKCLLNNADLAPHHPKDPVEM
RRINFQTPGMLSHPPIPIGDMAEHTERLKANDSLKLSQEYESIDPGQQFTWEHSNLEVNK
PKNRYANVIAYDHSRVILQPIEGIVGSDYINANYVDGYRRQNAYIATQGPLPETFGDFWR
MVWEQRSATIVMMTRLEEKSRIKCDQYWPNRGTETYGFIQVTLLDTIELATFCVRTFSLH
KSGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIVVHCSAGVGRTG
CFIVIDAMLERIKPEKTVDVYGHVTLMRSQRNYMVQTEDQYSFIHEALLEAVGCGNTEVP
ARSLYAYIQKLTQVEPGEHVTGMELEFKRLANSKAHTSRFISANLPCNKFKNRLVNIMPY
ESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTIVV
MLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVR
QFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVL
ERMRYEGVVDIFQTVKMLRTQRPAMVQMEDEYQFCYQAALEYLGSFDHYAT
Download sequence
Identical sequences E1BIU8
9913.ENSBTAP00000042388 ENSBTAP00000042388 ENSBTAP00000042388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]