SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000042745 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000042745
Domain Number 1 Region: 19-213
Classification Level Classification E-value
Superfamily L domain-like 1.7e-38
Family Internalin LRR domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000042745   Gene: ENSBTAG00000031981   Transcript: ENSBTAT00000045347
Sequence length 214
Comment pep:known chromosome:UMD3.1:10:37989936:37995280:-1 gene:ENSBTAG00000031981 transcript:ENSBTAT00000045347 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNSALRAHVETAQKTGVFQLKDRGLTEFPSELQKLTSNLRTIDLSNNKIENLPPMIIGK
FTLLKSLSLNNNKLTALPDELCNLKKLETLSLNNNQLRELPSTFGQLSALKTLSLSGNQL
RALPPQLCSLRHLDVVDLSKNQIRSILDTVGELQVIELNLNQNQISQISVKISSCPRLKV
LRLEENCLELSMLPQSILSDSQICLLAVEGNLFE
Download sequence
Identical sequences F6Q0Z5
ENSBTAP00000042745 ENSBTAP00000042745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]