SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000042822 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000042822
Domain Number 1 Region: 9-124
Classification Level Classification E-value
Superfamily POZ domain 2.67e-24
Family BTB/POZ domain 0.0013
Further Details:      
 
Domain Number 2 Region: 381-433
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000573
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 331-386
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000232
Family Classic zinc finger, C2H2 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000042822   Gene: ENSBTAG00000032031   Transcript: ENSBTAT00000045434
Sequence length 459
Comment pep:known chromosome:UMD3.1:23:27274034:27275413:1 gene:ENSBTAG00000032031 transcript:ENSBTAT00000045434 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGVEVLRFQLPGHEAATLRNMNQLRAEERFCDVTIVADSLKFRGHKVILAACSPFLRD
QFLLNPSSELQVSLMHSARIVADLLLSCYTGALEFAVRDIVNYLTAASYLQMEHVVEKCR
NALSQFIEPKIGLKEDGVSDASLVSSVSATKSLLPPARTPKPAPKPPPPPPLPPPLLRPV
KLEFPLDEDLELKAEEEDEDEDEDVSDICIVKVESALEVAHRLKPPGGLGGGLGIGGSVG
SHLGELAQSSVPPSTVAPPQGVVKACYSLSEDAEGEGLLLIPGGRASVGATSGLVEAAAV
AMAARGAGGSLGAGGGRGPLPGGFSSGNPLKNIKCTKCPEVFQGVEKLVFHMRAQHFIFM
CPRCGKQFNHSSNLNRHMNVHRGVKSHSCGICGKCFTQKSTLHDHLNLHSGARPYRCSYC
DVRFAHKPAIRRHLKEQHGKTTAENVLEASVAEINVLIR
Download sequence
Identical sequences F1MXC9
ENSBTAP00000042822 XP_005196655.1.59421 XP_005223753.1.76553 XP_006041941.1.26621 XP_010816681.1.76553 XP_010816682.1.76553 XP_010816683.1.76553 XP_010823632.1.59421 XP_010823633.1.59421 XP_010823634.1.59421 XP_012018829.1.54773 XP_015315391.1.76553 XP_015324425.1.59421 XP_017894188.1.57651 XP_020752931.1.74333 ENSBTAP00000042822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]