SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000043007 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000043007
Domain Number 1 Region: 157-421
Classification Level Classification E-value
Superfamily Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor 1.57e-98
Family Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor 0.000000568
Further Details:      
 
Domain Number 2 Region: 4-140
Classification Level Classification E-value
Superfamily SNARE-like 9.46e-41
Family Clathrin coat assembly domain 0.0000511
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000043007   Gene: ENSBTAG00000021160   Transcript: ENSBTAT00000045632
Sequence length 423
Comment pep:known chromosome:UMD3.1:7:16302066:16312788:-1 gene:ENSBTAG00000021160 transcript:ENSBTAT00000045632 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSASAVFILDVKGKPLISRNYKGDVAMSEIDHFMPLLMQREEEGALTPLLSHGRVHFLWI
KYSNLYLVATTLKNANASLVYSFLYKIVEVFSEYFKELEEESIRDNFVIVYELLDELMDF
GFPQTTDSKILQEYITQQGNKLETGKSRVPPTVTNAVSWRSEGIKYKKNEVFIDVIESVN
LLVNANGSVLLSEIVGSIKLKVFLSGMPELRLGLNDRVLFELTGRSKNKSVELEDVKFHQ
CVRLSRFDNDRTISFIPPDGDFELMSYRLSTQVKPLIWIESVIEKFSHSRVEIMVKAKGQ
FKKQSVANGVEISVPVPSDADSPRFKTSVGSAKYVPEKNTVIWSIKSFPGGKEYLMRAHF
GLPSVEKEEVEGRPPIGVKFEIPYFTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQL
RTS
Download sequence
Identical sequences Q3SYW1
9913.ENSBTAP00000043007 ENSBTAP00000043007 ENSBTAP00000043007 NP_001029683.1.59421 NP_001029683.1.76553 XP_005890857.1.15283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]