SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000043269 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000043269
Domain Number 1 Region: 78-254
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.96e-21
Family Ypt/Rab-GAP domain of gyp1p 0.017
Further Details:      
 
Domain Number 2 Region: 229-308
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.00000000000628
Family Ypt/Rab-GAP domain of gyp1p 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000043269   Gene: ENSBTAG00000032364   Transcript: ENSBTAT00000045920
Sequence length 309
Comment pep:known chromosome:UMD3.1:7:16607194:16615398:-1 gene:ENSBTAG00000032364 transcript:ENSBTAT00000045920 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAASNMEKLETLLALEPEEIITKYEQGHAGRMREPGEDTDLSLYSVANRLGSLLKTHLVS
RASVSEAQKAQDLRGADKWVKKLRSWQKYQGSTKMCRRVSMGIPPPVRGQAWSLLWDLEK
VKAENIRKYQSIKEQARRCCPDVKHIDVDINRAFRNNLFFWERNGIKQQALFHVLVAYSM
YDTENICAPRPCPFQGVFLLVTNQEHPGAEGLVQLMTEDKHTMGGFIPGFPKMPRFQAHH
KHILGRALPKLKGHVPMSAGIYTPTWFMQCFINQPPFPLTLRLWEASILEGGHLLTAMAY
TVLKVHRRK
Download sequence
Identical sequences E1BKG0
ENSBTAP00000043269 ENSBTAP00000043269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]