SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000043340 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000043340
Domain Number 1 Region: 303-347
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.47e-16
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 2 Region: 336-371
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000695
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000043340   Gene: ENSBTAG00000006083   Transcript: ENSBTAT00000046003
Sequence length 372
Comment pep:known chromosome:UMD3.1:7:13785087:13789391:1 gene:ENSBTAG00000006083 transcript:ENSBTAT00000046003 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAETALPSISTLTALGPFSDTQEDILKWWRSEDVQDLGPGPPDHTGPPLHVRPELEDA
PGEDEDDDRDAATPWDLDLLFTNFPCPEPGGAPQTCAPQTCAPQACALAPSEGSGAQFPP
PPETLGAYAGGPGLVAGLLGPEEHLGWARPAPRTPAPDTFVGPSLIPTPEPKALPLQPLY
PGPGSGSSGSYFPRTGLSVPAAPGAPYGLLSGYPALYPMPQYQGHFQLFRGLQAPAPGPP
SPHSFLSCLGPGTTGAGLGGTTGDPGGTTEAAPSKRSRRSWARKRQAAHTCTHPGCGKSY
TKSSHLKAHLRTHTGEKPYACTWDGCGWRFARSDELTRHYRKHTGQRPFRCQLCSRAFSR
SDHLALHMKRHL
Download sequence
Identical sequences Q0P5B6
NP_001073828.1.59421 NP_001073828.1.76553 ENSBTAP00000043340 ENSBTAP00000043340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]