SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000043387 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000043387
Domain Number 1 Region: 1-137
Classification Level Classification E-value
Superfamily SNARE-like 4.53e-42
Family Clathrin coat assembly domain 0.0000676
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000043387   Gene: ENSBTAG00000017201   Transcript: ENSBTAT00000046059
Sequence length 144
Comment pep:known chromosome:UMD3.1:21:42070332:42117187:1 gene:ENSBTAG00000017201 transcript:ENSBTAT00000046059 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIKFFLMVNKQGQTRLSKYYEHVEINKRTLLETEVIKSCLSRSNEQCSFIEYKDFKLIYR
QYAALFIVVGVNDTENEMAIYEFIHNFVEVLDDYFSRVSELDIMFNLDKVHIILDEMVLN
GCIVETNRARILAPLLILDKMSDS
Download sequence
Identical sequences Q3ZBB6
NP_001035693.1.59421 NP_001035693.1.76553 XP_007113429.1.24612 XP_007451332.1.90284 XP_017921393.1.57651 XP_019779642.1.83887 XP_019779643.1.83887 XP_019779644.1.83887 XP_019779645.1.83887 XP_019779647.1.83887 XP_019779648.1.83887 XP_019779649.1.83887 ENSBTAP00000043387 9913.ENSBTAP00000043387 ENSBTAP00000043387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]