SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000043751 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000043751
Domain Number 1 Region: 9-127
Classification Level Classification E-value
Superfamily POZ domain 5.76e-23
Family BTB/POZ domain 0.00084
Further Details:      
 
Domain Number 2 Region: 448-505
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.52e-22
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 3 Region: 546-598
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.76e-20
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 4 Region: 504-561
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.26e-19
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 5 Region: 411-462
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000147
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 353-401
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000211
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 7 Region: 321-363
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000266
Family Classic zinc finger, C2H2 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000043751   Gene: ENSBTAG00000008908   Transcript: ENSBTAT00000046451
Sequence length 711
Comment pep:known chromosome:UMD3.1:13:42407301:42413062:1 gene:ENSBTAG00000008908 transcript:ENSBTAT00000046451 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESGAVLLESKSSPINLLHEMHQLRLLGHLCDVTVSVEYQGVREEFMAHKAVLAATSKFF
KEVFLNEKTVDGARTNVYLDEVQVADFASFLEFVYTAKVQVEEDRVQRMLEMAEKLKCLD
LSETCFQLKKQMLESVLLELQNFSESQEAEGSSGAQVTAALAPEAWAGMAPDGPLANGVA
SSLDPPAERIGNGLLPDLPPRKSREKPDKRKEVAKPPYPKLRRASGRLAGRKVFVEIPKK
KYTRRLREQQKSVEQDMGGCGGPREPSPEALENEKEAVTKDEEDSGAGAGVEAAPPKVGR
GEEGDEEEEEGEEGPGRRRSNFQCTRCEKAFLYEKSFLKHVRLHHGVATEVVHRCDTCGQ
TFANRCNLKGHQRHVHSSERHFPCELCGKKFKRKKDVKRHVVQVHEGGGERHQCQQCGKG
LSSKTALRLHERTHTGHKPYGCSECPATFSQPSALKTHLRIHTGEKPFVCDECGARFTQN
HMLIYHKRCHTGERPFMCETCGKSFASKEYLKHHNRIHTGSKPFKCEVCFRTFAQRNSLY
QHIKVHTGERPYCCDQCGKQFTQLNALQRHHRIHTGEKPFMCNACGRAFTDKSTLRRHTS
IHDKTTPWKSFLVIVDGSPKNGDGHKTEQPDDEYAPSKLSDKLLSFAENGHFHNLATVQG
SMPAMHEDSPADPACKSDGPVGSQDTLLATAISELSELTPQTEPGPHSSAL
Download sequence
Identical sequences E1BIC9
XP_002692209.1.76553 XP_005214471.1.76553 XP_010809607.1.76553 XP_015321471.1.59421 XP_015321472.1.59421 XP_015321473.1.59421 XP_015321474.1.59421 XP_015329555.1.76553 ENSBTAP00000043751 ENSBTAP00000043751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]