SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000044222 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000044222
Domain Number 1 Region: 3-89
Classification Level Classification E-value
Superfamily EF-hand 1.02e-17
Family S100 proteins 0.0000677
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000044222   Gene: ENSBTAG00000039105   Transcript: ENSBTAT00000046979
Sequence length 99
Comment pep:known chromosome:UMD3.1:3:16880769:16884904:1 gene:ENSBTAG00000039105 transcript:ENSBTAT00000046979 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLLEQALATLVRTFQEYSQFSGNPLCQAKFKELLEKELPTWAPTTLRECDYKQFISVL
DTNKDCQVDFVEYMRLLACLCIYCHEYFKDSPLKPSCAQ
Download sequence
Identical sequences A4FUH7 L8HS94
ENSBTAP00000044222 9913.ENSBTAP00000044222 NP_001076999.1.59421 NP_001076999.1.76553 XP_005910070.1.15283 XP_010836720.1.44457 XP_010836721.1.44457 XP_010836722.1.44457 XP_019813906.1.53367 ENSBTAP00000044222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]