SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000044529 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000044529
Domain Number 1 Region: 165-282
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.62e-21
Family Ypt/Rab-GAP domain of gyp1p 0.0081
Further Details:      
 
Domain Number 2 Region: 41-187
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.51e-17
Family Ypt/Rab-GAP domain of gyp1p 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000044529   Gene: ENSBTAG00000007800   Transcript: ENSBTAT00000047313
Sequence length 299
Comment pep:known chromosome:UMD3.1:10:20524293:20537916:1 gene:ENSBTAG00000007800 transcript:ENSBTAT00000047313 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTLSPENSLSARQSASFILVKRKPPIDKTEWDGFFDENGHLAKSRDFICVNILERGLHP
TVRTEAWKFLTGYYSWQSSQDERLTVDSTRRKNYEALCQMYQKIQPLLENLHRNFIETRN
SIKYQQGFHEMVMIFQLMVEHDHETFWLFQFFLQKTEHSCVINIGVGKNLDMLNTLINFL
DPVFAEHLKGKGAGAVPSLFPWFCLCFQRAFKTFDDVWRLWEVLLTGKPCRNFQVLVAYS
MLQMVRQQVLQESMTGDDILLACNNLIDLDADELISAACIVYAELIQKDVPQSLKDFFL
Download sequence
Identical sequences F1MK40
ENSBTAP00000044529 ENSBTAP00000044529 XP_005910338.1.15283 XP_010829674.1.44457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]