SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000044561 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000044561
Domain Number 1 Region: 124-178
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000137
Family HkH motif-containing C2H2 finger 0.017
Further Details:      
 
Domain Number 2 Region: 62-109
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000111
Family HkH motif-containing C2H2 finger 0.0057
Further Details:      
 
Domain Number 3 Region: 6-49
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000278
Family HkH motif-containing C2H2 finger 0.0025
Further Details:      
 
Domain Number 4 Region: 186-228
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000554
Family C2HC finger 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000044561   Gene: ENSBTAG00000017420   Transcript: ENSBTAT00000047349
Sequence length 229
Comment pep:known chromosome:UMD3.1:27:35241299:35618997:-1 gene:ENSBTAG00000017420 transcript:ENSBTAT00000047349 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSSDIDQDLFTDSYCKVCSAQLISESQRVAHYESRKHASKVRLYYMLHPRDGGCPAKRL
RSENGNDADMVDKNKCCTLCNMSFTSAVVADSHYQGKIHAKRLKLLLGEKTPLKTTATPL
SSLKPPRVDTAPVVPSPYQRRDSDRYCGLCAAWFNNPLMAQQHYDGKKHKKNAARVALLE
QLGTTLDMGELRGLRRNYRCTTCSVSLNSIEQYHAHLKGSKHQTNLKNK
Download sequence
Identical sequences Q0VD35
ENSBTAP00000044561 9913.ENSBTAP00000044561 NP_001070411.1.59421 NP_001070411.1.76553 XP_005899895.1.15283 XP_010844669.1.44457 XP_019808898.1.53367 ENSBTAP00000044561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]