SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000044733 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000044733
Domain Number 1 Region: 4-352
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.7e-140
Family Calpain large subunit, catalytic domain (domain II) 0.00000000000532
Further Details:      
 
Domain Number 2 Region: 356-513
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 4.58e-58
Family Calpain large subunit, middle domain (domain III) 0.0000000256
Further Details:      
 
Domain Number 3 Region: 526-697
Classification Level Classification E-value
Superfamily EF-hand 2.82e-45
Family Penta-EF-hand proteins 0.000000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000044733   Gene: ENSBTAG00000012778   Transcript: ENSBTAT00000047532
Sequence length 700
Comment pep:known chromosome:UMD3.1:16:27781671:27840009:1 gene:ENSBTAG00000012778 transcript:ENSBTAT00000047532 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGIAAKLAKDREAAEGLGSHERAVKYLNQDYAALRDECLEAGALFQDPSFPALPSSLGF
KELGPYSSKTRGIEWKRPTEICDNPQFITGGATRTDICQGALGDCWLLAAIASLTLNEEI
LARVVPLDQSFQENYAGIFHFQFWQYGEWVEVVVDDRLPTKDGELLFVHSAEGSEFWSAL
LEKAYAKINGCYEALSGGATTEGFEDFTGGIAEWYELRKAPPNLFRIIQKALQKGSLLGC
SIDITSAADSEAITFQKLVKGHAYSVTGAEEVESRGSLQKLIRIRNPWGEVEWTGQWNDN
CPNWNTVDPEVRETLTRQHEDGEFWMSFNDFLRHYSRLEICNLTPDTLTSDSYKKWKLTK
MDGNWRRGSTAGGCRNYPNTFWMNPQYLIKLEEEDEDQEDGESGCTFLVGLIQKHRRRQR
KMGEDMHTIGFGIYEVPEELTGQTNIHLSKKFFLTTRARERSDTFINLREVLNRFKLPPG
EYIVVPSTFEPNKDGDFCIRVFSEKKADYQVVDDEIEANIDEIDISEDDIDDGFRRLFAQ
LAGEDAEISAFELQTILRRVLAKRQDIKSDGFSIETCKIMVDMLDSDGSGKLGLKEFYIL
WTKIQKYQKIYREIDVDRSGTMNSYEMRKALEEAGFKMPCQLHQVIVARFADDDLIIDFD
NFVRCLIRLETLFRIFKQLDPENTGMIQLDLISWLSFSVL
Download sequence
Identical sequences Q27971
NP_001096556.1.59421 NP_001096556.1.76553 XP_019831825.1.53367 ENSBTAP00000044733 ENSBTAP00000044733 9913.ENSBTAP00000044733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]